Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0058
Type: CDS
Description: identified by match to protein family HMM PF00639; NCBI:peptidylprolyl isomerase; IMG:peptidyl-prolyl cis-trans isomerase C
Source: GenBank
Position: DSS3:59912..60742 (+ strand)
Length: 831
Dbxref: GI:56694986
  GeneID:3196485
Note: identified by match to protein family HMM PF00639
  NCBI:peptidylprolyl isomerase
  IMG:peptidyl-prolyl cis-trans isomerase C
codon_start: 1
load_id: SPO0058.p01
parent_id: SPO0058.t01
product: PPIC-type PPIASE domain protein
protein_id: REF_tigr:SPO0058
  YP_165332.1
transl_table: 11
translation: MPSLAFALVMALPVAAETKAEADTVVARVNGEEITLGHMIIARASLPQQYQQLPDDVLFD GILDQLVQQTLLKQQQKGETPKQIVLSLENEERSLLAGETIEEIMAVATTETAIQAAYDA QYADGFGGEEYNASHILVPSEDEAKAVKELLDNGADFAATAKEKSTGPSGPNGGALGWFG AGAMVPEFEQAVVALNAGQVSDPVQTQFGWHVIILNDKRKSEAPALDEVRDELAGRIQQD AIEARLAELTKDSEIEKPELTGVEPAVLRQLELVRE
>SPO0058 class=Sequence position=DSS3:59912..60742 (+ strand)
TTGCCATCGC TGGCGTTTGC GCTGGTCATG GCCCTGCCGG TCGCGGCCGA GACAAAGGCC GAGGCGGACA CGGTTGTGGC
CCGCGTCAAT GGCGAAGAGA TCACGCTGGG TCACATGATC ATCGCGCGCG CCTCGCTGCC GCAGCAGTAT CAGCAATTGC
CCGACGATGT GCTGTTCGAC GGTATCCTGG ACCAGCTGGT CCAGCAGACC CTGCTGAAAC AGCAGCAGAA GGGCGAGACC
CCGAAACAGA TCGTGTTGTC GCTGGAGAAC GAGGAACGCT CCTTGCTGGC GGGTGAGACC ATCGAAGAGA TCATGGCCGT
CGCAACCACC GAAACGGCGA TCCAGGCGGC TTATGACGCG CAATATGCCG ATGGGTTCGG CGGCGAGGAA TACAATGCCT
CGCATATCCT GGTCCCCTCC GAGGACGAGG CCAAGGCCGT CAAGGAACTG CTCGACAATG GCGCCGATTT CGCCGCCACC
GCCAAGGAGA AATCCACAGG TCCGTCCGGG CCCAATGGCG GTGCGCTGGG CTGGTTCGGT GCCGGCGCGA TGGTGCCGGA
ATTCGAACAG GCGGTTGTGG CGCTGAACGC GGGTCAGGTT TCGGACCCGG TGCAGACCCA GTTCGGCTGG CATGTGATCA
TCCTCAATGA CAAGCGCAAG TCCGAGGCGC CGGCGCTGGA CGAGGTGCGT GACGAACTTG CGGGCCGTAT CCAGCAGGAC
GCCATCGAGG CGCGGCTGGC CGAGCTGACC AAGGACAGCG AGATTGAAAA GCCCGAGCTG ACCGGGGTCG AACCCGCCGT
GCTGCGGCAA TTGGAACTGG TGCGGGAGTA A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7