Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0062
Type: gene
Description:
Source: Genbank
Position: CP000031.2:65364..65987 (- strand)
Length: 624
gbkey: Gene
gene: SPO0062
gene_biotype: protein_coding
load_id: gene-SPO0062
locus_tag: SPO0062
Parts:
Type: CDS
Description: identified by similarity to GB:AAK22031.1; match to protein family HMM PF04296
Source: Genbank
Position: CP000031.2:65364..65987 (- strand)
Length: 624
Dbxref: NCBI_GP:AAV93393.1
IMG: SPO0062: hypothetical protein
Note: identified by similarity to GB:AAK22031.1; match to protein family HMM PF04296
RefSeq: SPO_RS00315: RNA-binding protein
gbkey: CDS
gene: SPO0062
load_id: cds-AAV93393.1
locus_tag: SPO0062
parent_id: gene-SPO0062
product: hypothetical protein
protein_id: AAV93393.1
transl_table: 11
translation: MTRGGAHKDRTEGPERKCIATGESQPRFGLIRFVAGPDGQLVPDIAGKLPGRGTYVAADR EALQKAVDKKLFARGLKQQVQVPDGLVDEVERQLIRRVVDLLSLARKSGDAVSGYEKVKT WLDKEEAQVLIQASDGSGRGKTKLSTPHFGKYIGWLTADELGMAFGRQTVIHAALASGGL AKRVVEEAQRLRGMRKTDDGGKGRAEG
>SPO0062 class=Sequence position=CP000031.2:65364..65987 (- strand)
ATGACACGTG GCGGTGCACA TAAAGACCGG ACCGAAGGTC CCGAACGCAA GTGCATTGCC ACGGGCGAAT CGCAGCCTAG
ATTCGGGCTT ATCCGATTCG TGGCCGGCCC CGACGGGCAA TTGGTGCCCG ATATCGCGGG CAAACTTCCC GGGCGCGGCA
CCTATGTGGC CGCAGACCGG GAGGCATTGC AAAAGGCGGT GGACAAGAAA CTCTTTGCCC GCGGCCTGAA ACAGCAGGTG
CAGGTGCCCG ACGGGCTGGT GGACGAGGTC GAACGGCAAC TGATCCGTCG CGTCGTCGAT CTGCTCAGCC TGGCCCGCAA
ATCCGGCGAC GCGGTCTCGG GATATGAAAA GGTCAAGACC TGGCTCGACA AGGAAGAGGC GCAGGTCCTG ATCCAGGCCT
CGGACGGATC AGGCCGGGGC AAGACCAAAC TGAGCACGCC GCATTTCGGC AAATACATTG GTTGGCTCAC GGCGGATGAA
TTGGGCATGG CTTTTGGCCG CCAAACAGTG ATACATGCGG CGCTGGCCTC TGGTGGACTC GCCAAACGTG TTGTAGAGGA
AGCGCAACGC CTTCGTGGAA TGCGCAAAAC GGATGACGGC GGCAAGGGCC GCGCGGAAGG GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7