Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0062
Type: CDS
Description: identified by similarity to GB:AAK22031.1; match to protein family HMM PF04296; NCBI:hypothetical protein; IMG:hypothetical protein
Source: GenBank
Position: DSS3:65364..65987 (- strand)
Length: 624
Dbxref: GI:56694990
  GeneID:3194394
Note: identified by similarity to GB:AAK22031.1; match to protein family HMM PF04296
  NCBI:hypothetical protein
  IMG:hypothetical protein
codon_start: 1
load_id: SPO0062.p01
parent_id: SPO0062.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0062
  YP_165336.1
transl_table: 11
translation: MTRGGAHKDRTEGPERKCIATGESQPRFGLIRFVAGPDGQLVPDIAGKLPGRGTYVAADR EALQKAVDKKLFARGLKQQVQVPDGLVDEVERQLIRRVVDLLSLARKSGDAVSGYEKVKT WLDKEEAQVLIQASDGSGRGKTKLSTPHFGKYIGWLTADELGMAFGRQTVIHAALASGGL AKRVVEEAQRLRGMRKTDDGGKGRAEG
>SPO0062 class=Sequence position=DSS3:65364..65987 (- strand)
ATGACACGTG GCGGTGCACA TAAAGACCGG ACCGAAGGTC CCGAACGCAA GTGCATTGCC ACGGGCGAAT CGCAGCCTAG
ATTCGGGCTT ATCCGATTCG TGGCCGGCCC CGACGGGCAA TTGGTGCCCG ATATCGCGGG CAAACTTCCC GGGCGCGGCA
CCTATGTGGC CGCAGACCGG GAGGCATTGC AAAAGGCGGT GGACAAGAAA CTCTTTGCCC GCGGCCTGAA ACAGCAGGTG
CAGGTGCCCG ACGGGCTGGT GGACGAGGTC GAACGGCAAC TGATCCGTCG CGTCGTCGAT CTGCTCAGCC TGGCCCGCAA
ATCCGGCGAC GCGGTCTCGG GATATGAAAA GGTCAAGACC TGGCTCGACA AGGAAGAGGC GCAGGTCCTG ATCCAGGCCT
CGGACGGATC AGGCCGGGGC AAGACCAAAC TGAGCACGCC GCATTTCGGC AAATACATTG GTTGGCTCAC GGCGGATGAA
TTGGGCATGG CTTTTGGCCG CCAAACAGTG ATACATGCGG CGCTGGCCTC TGGTGGACTC GCCAAACGTG TTGTAGAGGA
AGCGCAACGC CTTCGTGGAA TGCGCAAAAC GGATGACGGC GGCAAGGGCC GCGCGGAAGG GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7