Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0064
Type: gene
Description:
Source: GenBank
Position: DSS3:67637..68263 (- strand)
Length: 627
Dbxref: GeneID:3194733
load_id: SPO0064
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:67637..68263 (- strand)
Length: 627
load_id: SPO0064.t01
parent_id: SPO0064
Parts:
Type: CDS
Description: identified by similarity to SP:Q8UJ48; match to protein family HMM PF02576; NCBI:ribosome maturation factor; IMG:ribosome maturation factor RimP
Source: GenBank
Position: DSS3:67637..68263 (- strand)
Length: 627
Dbxref: GI:56694992
  GeneID:3194733
Note: identified by similarity to SP:Q8UJ48; match to protein family HMM PF02576
  NCBI:ribosome maturation factor
  IMG:ribosome maturation factor RimP
codon_start: 1
load_id: SPO0064.p01
parent_id: SPO0064.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0064
  YP_165338.1
transl_table: 11
translation: MTNNLIAKAAIDRRLAEIVSPVIADLGYELVRIRLMSGKSTTLQIMADKPDGGIEVDDCA AISNAVSATLDVEDPILDAYTLEVSSPGIDRPLTRLKDFEMFEGYEAKIETTEMIDGRRR FRGELAGIEGNEVLINLDQNGETVTIGLEFDWLSDAKLVLTDDLIKEMLRQRKAAGVLNE DQFDEIVEEAPETGATTMARDGSEEETK
Type: exon
Description:
Source: GenBank
Position: DSS3:67637..68263 (- strand)
Length: 627
parent_id: SPO0064.t01
> class=Sequence position=DSS3:67637..68263 (- strand)
ATGACCAACA ACCTGATAGC AAAGGCCGCC ATCGACCGGC GCCTGGCCGA GATCGTCAGC CCCGTGATCG CGGATCTGGG
ATACGAGCTG GTGCGCATTC GCCTGATGAG CGGCAAGAGC ACCACGCTTC AGATCATGGC CGACAAGCCC GATGGCGGCA
TCGAGGTGGA CGATTGCGCC GCGATCTCGA ACGCGGTCAG CGCCACGCTG GATGTCGAGG ATCCGATCCT GGATGCCTAT
ACGCTCGAAG TGTCGAGCCC GGGCATCGAC CGGCCGCTGA CCCGGCTCAA GGATTTCGAG ATGTTCGAAG GCTATGAGGC
CAAGATCGAA ACGACCGAGA TGATCGACGG CCGCCGCCGG TTCAGGGGCG AGCTGGCCGG CATCGAGGGC AACGAGGTGC
TGATCAACCT CGACCAGAAT GGCGAGACGG TGACCATCGG CCTGGAGTTC GACTGGCTGA GCGATGCCAA GCTGGTTCTG
ACCGACGACC TGATCAAGGA AATGCTGCGC CAGCGCAAGG CTGCCGGTGT CCTGAACGAA GATCAATTCG ACGAAATCGT
AGAGGAAGCG CCCGAAACGG GCGCCACGAC CATGGCCCGC GACGGGTCCG AAGAGGAGAC GAAGTAA
>SPO0064 class=Sequence position=DSS3:67637..68263 (- strand)
ATGACCAACA ACCTGATAGC AAAGGCCGCC ATCGACCGGC GCCTGGCCGA GATCGTCAGC CCCGTGATCG CGGATCTGGG
ATACGAGCTG GTGCGCATTC GCCTGATGAG CGGCAAGAGC ACCACGCTTC AGATCATGGC CGACAAGCCC GATGGCGGCA
TCGAGGTGGA CGATTGCGCC GCGATCTCGA ACGCGGTCAG CGCCACGCTG GATGTCGAGG ATCCGATCCT GGATGCCTAT
ACGCTCGAAG TGTCGAGCCC GGGCATCGAC CGGCCGCTGA CCCGGCTCAA GGATTTCGAG ATGTTCGAAG GCTATGAGGC
CAAGATCGAA ACGACCGAGA TGATCGACGG CCGCCGCCGG TTCAGGGGCG AGCTGGCCGG CATCGAGGGC AACGAGGTGC
TGATCAACCT CGACCAGAAT GGCGAGACGG TGACCATCGG CCTGGAGTTC GACTGGCTGA GCGATGCCAA GCTGGTTCTG
ACCGACGACC TGATCAAGGA AATGCTGCGC CAGCGCAAGG CTGCCGGTGT CCTGAACGAA GATCAATTCG ACGAAATCGT
AGAGGAAGCG CCCGAAACGG GCGCCACGAC CATGGCCCGC GACGGGTCCG AAGAGGAGAC GAAGTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7