Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0065
Type: gene
Description:
Source: Genbank
Position: CP000031.2:68420..69241 (- strand)
Length: 822
gbkey: Gene
gene: SPO0065
gene_biotype: protein_coding
load_id: gene-SPO0065
locus_tag: SPO0065
Parts:
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:68420..69241 (- strand)
Length: 822
"ID: cds-AAV93396.1
Dbxref: NCBI_GP:AAV93396.1
IMG:
RefSeq: SPO_RS00330: peptide ABC transporter substrate-binding protein"
gbkey: CDS
gene: SPO0065
locus_tag: SPO0065
parent_id: gene-SPO0065
product: peptide/opine/nickel uptake family ABC transporter
  periplasmic substrate-binding protein
protein_id: AAV93396.1
transl_table: 11
translation: MTRIDRRALFASGAAAALLASAGMSLADRPRAGGSLRLAVPRDDSLERIARGAVFDTLTE IAPDGTLRGELATGWQPDDSARVWSFDLREDVTFHDGTRFSASDAAASLAEIGLAEALGP TRLRLELAEADPGLPFRLADTRFAITRAGGAVTPLEQANGTGCYRVERAQDGRHFLGRKV VGHYKQGQAGWADTVEVIVIPDPAVRAEALRDGYVDVAALPLPDGLRDRTRFRYHPSEDD MALAAAVSVGLPRQISSRSALDDGRLAERWWVG
>SPO0065 class=Sequence position=CP000031.2:68420..69241 (- strand)
ATGACCCGGA TCGACCGCCG CGCGCTGTTT GCCTCGGGTG CCGCCGCCGC GCTCTTGGCC TCGGCGGGCA TGTCGCTGGC
CGACCGGCCC CGGGCGGGGG GCAGCCTGCG CCTGGCGGTG CCGCGCGATG ACAGTCTGGA ACGGATCGCG CGCGGCGCGG
TGTTCGACAC CTTGACCGAG ATTGCCCCCG ACGGCACCCT CAGGGGAGAG CTGGCAACCG GCTGGCAACC CGATGACAGC
GCCCGGGTCT GGAGCTTTGA TCTGCGCGAA GACGTCACCT TTCACGATGG CACGCGATTC TCTGCCAGCG ATGCCGCTGC
GTCGCTCGCC GAAATCGGCC TGGCCGAGGC GCTTGGCCCC ACGCGGCTGC GGCTGGAACT GGCCGAGGCC GATCCGGGCC
TGCCCTTCCG GCTGGCCGAT ACCCGCTTTG CCATCACCCG CGCCGGCGGG GCGGTCACGC CGCTGGAGCA GGCCAACGGC
ACCGGTTGCT ACCGGGTCGA ACGGGCGCAG GACGGGCGGC ACTTCCTCGG CCGCAAGGTG GTGGGGCATT ACAAGCAAGG
TCAGGCCGGT TGGGCCGACA CGGTCGAGGT GATCGTGATC CCCGACCCCG CGGTCCGGGC CGAGGCGCTG CGCGACGGCT
ATGTCGATGT CGCCGCCCTG CCCCTGCCCG ACGGGCTGCG CGATCGCACC CGGTTCCGCT ATCACCCCTC CGAGGACGAC
ATGGCGCTTG CCGCCGCCGT CTCGGTCGGC CTGCCGCGCC AGATCAGCAG CCGCAGCGCA TTGGACGATG GCCGCCTCGC
GGAACGCTGG TGGGTGGGAT AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7