Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0065
Type: gene
Description:
Source: GenBank
Position: DSS3:68420..69241 (- strand)
Length: 822
Dbxref: GeneID:3192830
load_id: SPO0065
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:68420..69241 (- strand)
Length: 822
load_id: SPO0065.t01
parent_id: SPO0065
Parts:
Type: CDS
Description: NCBI:peptide ABC transporter substrate-binding protein; IMG:extracellular solute-binding protein; family 5 Middle
Source: GenBank
Position: DSS3:68420..69241 (- strand)
Length: 822
Dbxref: GI:56694993
  GeneID:3192830
Note: NCBI:peptide ABC transporter substrate-binding protein
  IMG:extracellular solute-binding protein
  family 5 Middle
codon_start: 1
load_id: SPO0065.p01
parent_id: SPO0065.t01
product: peptide/opine/nickel uptake family ABC transporter, periplasmic substrate-binding protein
protein_id: REF_tigr:SPO0065
  YP_165339.1
transl_table: 11
translation: MTRIDRRALFASGAAAALLASAGMSLADRPRAGGSLRLAVPRDDSLERIARGAVFDTLTE IAPDGTLRGELATGWQPDDSARVWSFDLREDVTFHDGTRFSASDAAASLAEIGLAEALGP TRLRLELAEADPGLPFRLADTRFAITRAGGAVTPLEQANGTGCYRVERAQDGRHFLGRKV VGHYKQGQAGWADTVEVIVIPDPAVRAEALRDGYVDVAALPLPDGLRDRTRFRYHPSEDD MALAAAVSVGLPRQISSRSALDDGRLAERWWVG
Type: exon
Description:
Source: GenBank
Position: DSS3:68420..69241 (- strand)
Length: 822
parent_id: SPO0065.t01
> class=Sequence position=DSS3:68420..69241 (- strand)
ATGACCCGGA TCGACCGCCG CGCGCTGTTT GCCTCGGGTG CCGCCGCCGC GCTCTTGGCC TCGGCGGGCA TGTCGCTGGC
CGACCGGCCC CGGGCGGGGG GCAGCCTGCG CCTGGCGGTG CCGCGCGATG ACAGTCTGGA ACGGATCGCG CGCGGCGCGG
TGTTCGACAC CTTGACCGAG ATTGCCCCCG ACGGCACCCT CAGGGGAGAG CTGGCAACCG GCTGGCAACC CGATGACAGC
GCCCGGGTCT GGAGCTTTGA TCTGCGCGAA GACGTCACCT TTCACGATGG CACGCGATTC TCTGCCAGCG ATGCCGCTGC
GTCGCTCGCC GAAATCGGCC TGGCCGAGGC GCTTGGCCCC ACGCGGCTGC GGCTGGAACT GGCCGAGGCC GATCCGGGCC
TGCCCTTCCG GCTGGCCGAT ACCCGCTTTG CCATCACCCG CGCCGGCGGG GCGGTCACGC CGCTGGAGCA GGCCAACGGC
ACCGGTTGCT ACCGGGTCGA ACGGGCGCAG GACGGGCGGC ACTTCCTCGG CCGCAAGGTG GTGGGGCATT ACAAGCAAGG
TCAGGCCGGT TGGGCCGACA CGGTCGAGGT GATCGTGATC CCCGACCCCG CGGTCCGGGC CGAGGCGCTG CGCGACGGCT
ATGTCGATGT CGCCGCCCTG CCCCTGCCCG ACGGGCTGCG CGATCGCACC CGGTTCCGCT ATCACCCCTC CGAGGACGAC
ATGGCGCTTG CCGCCGCCGT CTCGGTCGGC CTGCCGCGCC AGATCAGCAG CCGCAGCGCA TTGGACGATG GCCGCCTCGC
GGAACGCTGG TGGGTGGGAT AG
>SPO0065 class=Sequence position=DSS3:68420..69241 (- strand)
ATGACCCGGA TCGACCGCCG CGCGCTGTTT GCCTCGGGTG CCGCCGCCGC GCTCTTGGCC TCGGCGGGCA TGTCGCTGGC
CGACCGGCCC CGGGCGGGGG GCAGCCTGCG CCTGGCGGTG CCGCGCGATG ACAGTCTGGA ACGGATCGCG CGCGGCGCGG
TGTTCGACAC CTTGACCGAG ATTGCCCCCG ACGGCACCCT CAGGGGAGAG CTGGCAACCG GCTGGCAACC CGATGACAGC
GCCCGGGTCT GGAGCTTTGA TCTGCGCGAA GACGTCACCT TTCACGATGG CACGCGATTC TCTGCCAGCG ATGCCGCTGC
GTCGCTCGCC GAAATCGGCC TGGCCGAGGC GCTTGGCCCC ACGCGGCTGC GGCTGGAACT GGCCGAGGCC GATCCGGGCC
TGCCCTTCCG GCTGGCCGAT ACCCGCTTTG CCATCACCCG CGCCGGCGGG GCGGTCACGC CGCTGGAGCA GGCCAACGGC
ACCGGTTGCT ACCGGGTCGA ACGGGCGCAG GACGGGCGGC ACTTCCTCGG CCGCAAGGTG GTGGGGCATT ACAAGCAAGG
TCAGGCCGGT TGGGCCGACA CGGTCGAGGT GATCGTGATC CCCGACCCCG CGGTCCGGGC CGAGGCGCTG CGCGACGGCT
ATGTCGATGT CGCCGCCCTG CCCCTGCCCG ACGGGCTGCG CGATCGCACC CGGTTCCGCT ATCACCCCTC CGAGGACGAC
ATGGCGCTTG CCGCCGCCGT CTCGGTCGGC CTGCCGCGCC AGATCAGCAG CCGCAGCGCA TTGGACGATG GCCGCCTCGC
GGAACGCTGG TGGGTGGGAT AG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7