Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0068
Type: gene
Description:
Source: Genbank
Position: CP000031.2:71105..71545 (- strand)
Length: 441
gbkey: Gene
gene: SPO0068
gene_biotype: protein_coding
load_id: gene-SPO0068
locus_tag: SPO0068
Parts:
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:71105..71545 (- strand)
Length: 441
"ID: cds-AAV93399.1
Dbxref: NCBI_GP:AAV93399.1
IMG: SPO0068: transcriptional regulator
  MarR family
RefSeq: SPO_RS00345: MarR family transcriptional regulator"
gbkey: CDS
gene: SPO0068
locus_tag: SPO0068
parent_id: gene-SPO0068
product: transcriptional regulator
  putative
protein_id: AAV93399.1
transl_table: 11
translation: MADEIHTLAVSLFSEILTADQLLRNRLSRVLPKGMEISHFSVLNHLVFVGDERTPAQLAS TFHVTRGAMTNTLAKLEWAGYIHIRPDWDDARRKMVAISPAGRQARDQAISMISPLIDQV VGELGAERVRLALPVLRDLRIKLEIN
>SPO0068 class=Sequence position=CP000031.2:71105..71545 (- strand)
ATGGCTGACG AGATCCACAC CCTGGCGGTA TCGCTGTTCA GCGAAATCCT GACAGCAGAT CAGCTGTTGC GCAACCGGCT
CAGCCGGGTG CTGCCCAAGG GCATGGAGAT CTCGCATTTC TCGGTCCTGA ACCACCTGGT CTTTGTCGGA GACGAGCGGA
CGCCGGCGCA ACTGGCCAGC ACATTTCACG TGACCCGCGG CGCGATGACC AATACGCTGG CCAAGCTGGA ATGGGCCGGA
TACATCCATA TCCGCCCGGA CTGGGACGAT GCCCGGCGCA AGATGGTGGC GATCAGCCCC GCCGGTCGCC AGGCGCGCGA
TCAGGCGATC TCGATGATCT CGCCGCTGAT TGATCAGGTC GTGGGCGAAT TGGGGGCCGA ACGGGTCAGG CTGGCTCTGC
CTGTGCTGCG CGATTTGCGG ATCAAACTGG AAATCAACTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7