Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0068
Type: CDS
Description: NCBI:MarR family transcriptional regulator; IMG:DNA-binding transcriptional regulator; MarR family
Source: GenBank
Position: DSS3:71105..71545 (- strand)
Length: 441
Dbxref: GI:56694996
  GeneID:3195175
Note: NCBI:MarR family transcriptional regulator
  IMG:DNA-binding transcriptional regulator
  MarR family
codon_start: 1
load_id: SPO0068.p01
parent_id: SPO0068.t01
product: transcriptional regulator, putative
protein_id: REF_tigr:SPO0068
  YP_165342.1
transl_table: 11
translation: MADEIHTLAVSLFSEILTADQLLRNRLSRVLPKGMEISHFSVLNHLVFVGDERTPAQLAS TFHVTRGAMTNTLAKLEWAGYIHIRPDWDDARRKMVAISPAGRQARDQAISMISPLIDQV VGELGAERVRLALPVLRDLRIKLEIN
>SPO0068 class=Sequence position=DSS3:71105..71545 (- strand)
ATGGCTGACG AGATCCACAC CCTGGCGGTA TCGCTGTTCA GCGAAATCCT GACAGCAGAT CAGCTGTTGC GCAACCGGCT
CAGCCGGGTG CTGCCCAAGG GCATGGAGAT CTCGCATTTC TCGGTCCTGA ACCACCTGGT CTTTGTCGGA GACGAGCGGA
CGCCGGCGCA ACTGGCCAGC ACATTTCACG TGACCCGCGG CGCGATGACC AATACGCTGG CCAAGCTGGA ATGGGCCGGA
TACATCCATA TCCGCCCGGA CTGGGACGAT GCCCGGCGCA AGATGGTGGC GATCAGCCCC GCCGGTCGCC AGGCGCGCGA
TCAGGCGATC TCGATGATCT CGCCGCTGAT TGATCAGGTC GTGGGCGAAT TGGGGGCCGA ACGGGTCAGG CTGGCTCTGC
CTGTGCTGCG CGATTTGCGG ATCAAACTGG AAATCAACTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7