Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0069
Type: CDS
Description: identified by match to protein family HMM PF00795
Source: Genbank
Position: CP000031.2:71558..72388 (- strand)
Length: 831
"ID: cds-AAV93400.1
Dbxref: NCBI_GP:AAV93400.1
IMG: SPO0069: hydrolase
  carbon-nitrogen family
Note: identified by match to protein family HMM PF00795
RefSeq: SPO_RS00350: carbon-nitrogen hydrolase family protein"
gbkey: CDS
gene: SPO0069
locus_tag: SPO0069
parent_id: gene-SPO0069
product: hydrolase
  carbon-nitrogen family
protein_id: AAV93400.1
transl_table: 11
translation: MKTALLQLTSSDDPAANLDMVRGMVAEAAAQGARWVLTPEVTNCVSNSTTRQREVLQHEE DDITLAGLRAQATELGIWLLIGSLGLKTHDADGRFANRSFMIGPDGGIVARYDKIHMFDV QVTETETFRESANYRPGDRAVLAPTEFGTVGMTICYDLRFPHLHAALAQAGATVLTVPAA FSPVTGAAHWESLLRARAIETGCWVLAPAQTGTHPNSRGKPRRTHGHSLVVAPWGEVRID AGSEPGIHIFDLDDTSVTEARRRVPSLTHKRAFDGP
>SPO0069 class=Sequence position=CP000031.2:71558..72388 (- strand)
ATGAAAACCG CGCTGCTGCA ACTCACCTCG TCGGACGACC CGGCGGCCAA TCTGGACATG GTTCGGGGCA TGGTTGCCGA
GGCCGCGGCA CAGGGCGCCC GCTGGGTGCT GACACCCGAG GTGACCAATT GTGTCTCGAA CAGCACCACA CGCCAGCGCG
AGGTGTTGCA GCACGAAGAG GACGACATCA CCCTGGCCGG GCTCAGGGCG CAGGCGACCG AGCTGGGCAT CTGGCTGCTG
ATCGGCTCGC TCGGGCTCAA GACGCATGAC GCCGATGGGC GGTTTGCCAA CCGCTCGTTC ATGATCGGAC CGGATGGGGG
GATCGTGGCC CGCTATGACA AGATCCACAT GTTCGACGTG CAGGTAACCG AGACCGAAAC CTTTCGCGAA TCGGCCAATT
ACCGGCCCGG TGACCGGGCC GTGCTGGCCC CGACCGAATT CGGCACCGTG GGCATGACGA TCTGCTACGA TCTGCGCTTT
CCGCATCTGC ACGCGGCGCT GGCACAGGCG GGGGCGACCG TCCTGACCGT TCCGGCAGCC TTTTCGCCGG TGACCGGTGC
CGCACATTGG GAATCGCTGC TCAGGGCGCG CGCGATCGAG ACGGGCTGCT GGGTATTGGC CCCGGCACAG ACCGGCACCC
ACCCAAACAG CCGCGGCAAA CCGCGCCGCA CTCACGGTCA CAGCCTGGTC GTTGCGCCCT GGGGAGAGGT GCGGATCGAC
GCAGGCAGCG AACCGGGGAT TCACATCTTC GATCTGGATG ATACATCTGT TACAGAGGCC CGGCGCAGAG TCCCAAGCTT
GACTCACAAA CGCGCCTTCG ATGGACCCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7