Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0070
Type: gene
Description:
Source: Genbank
Position: CP000031.2:72385..72645 (- strand)
Length: 261
gbkey: Gene
gene: SPO0070
gene_biotype: protein_coding
load_id: gene-SPO0070
locus_tag: SPO0070
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181
Source: Genbank
Position: CP000031.2:72385..72645 (- strand)
Length: 261
Dbxref: NCBI_GP:AAV93401.1
IMG: SPO0070: glutaredoxin
Note: identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181
RefSeq: SPO_RS00355: grxC: glutaredoxin 3
gbkey: CDS
gene: SPO0070
load_id: cds-AAV93401.1
locus_tag: SPO0070
parent_id: gene-SPO0070
product: glutaredoxin
protein_id: AAV93401.1
transl_table: 11
translation: MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMIQRAGGRRTVPQIFID GQHVGGCDDLYALEQDGKLDPMLASR
>SPO0070 class=Sequence position=CP000031.2:72385..72645 (- strand)
ATGAAACCCG TCGAAATCTA TACCTCACCG CTCTGCGGTT ACTGCCACGC GGCCAAGCGG CTGCTGGACC AGAAGGGCAT
CGCCTTTACC GAAATCGACG TGCTCACCAA CCCCAAGCGC AAGCCCGAGA TGATCCAGCG CGCGGGCGGG CGCCGCACGG
TGCCGCAGAT CTTCATCGAT GGACAGCATG TGGGCGGCTG CGACGATCTC TATGCGCTGG AACAGGACGG CAAGCTCGAC
CCGATGCTGG CCTCGAGATG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7