Parts: | Type: | CDS | Description: | identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181 | Source: | Genbank | Position: | CP000031.2:72385..72645 (- strand) | Length: | 261 | Dbxref: | NCBI_GP:AAV93401.1 | IMG: | SPO0070: glutaredoxin | Note: | identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181 | RefSeq: | SPO_RS00355: grxC: glutaredoxin 3
| gbkey: | CDS | load_id: | cds-AAV93401.1 | locus_tag: | SPO0070 | parent_id: | gene-SPO0070 | product: | glutaredoxin | protein_id: | AAV93401.1 | transl_table: | 11 | translation: | MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMIQRAGGRRTVPQIFID GQHVGGCDDLYALEQDGKLDPMLASR |
---|
| |
---|
|
---|