Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0070
Type: CDS
Description: identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181; NCBI:glutaredoxin 3; IMG:glutaredoxin 3
Source: GenBank
Position: DSS3:72385..72645 (- strand)
Length: 261
Dbxref: GI:56694998
  GeneID:3196331
Note: identified by match to protein family HMM PF00462; match to protein family HMM TIGR02181
  NCBI:glutaredoxin 3
  IMG:glutaredoxin 3
codon_start: 1
load_id: SPO0070.p01
parent_id: SPO0070.t01
product: glutaredoxin
protein_id: REF_tigr:SPO0070
  YP_165344.1
transl_table: 11
translation: MKPVEIYTSPLCGYCHAAKRLLDQKGIAFTEIDVLTNPKRKPEMIQRAGGRRTVPQIFID GQHVGGCDDLYALEQDGKLDPMLASR
>SPO0070 class=Sequence position=DSS3:72385..72645 (- strand)
ATGAAACCCG TCGAAATCTA TACCTCACCG CTCTGCGGTT ACTGCCACGC GGCCAAGCGG CTGCTGGACC AGAAGGGCAT
CGCCTTTACC GAAATCGACG TGCTCACCAA CCCCAAGCGC AAGCCCGAGA TGATCCAGCG CGCGGGCGGG CGCCGCACGG
TGCCGCAGAT CTTCATCGAT GGACAGCATG TGGGCGGCTG CGACGATCTC TATGCGCTGG AACAGGACGG CAAGCTCGAC
CCGATGCTGG CCTCGAGATG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7