Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0071
Type: gene
Description:
Source: Genbank
Position: CP000031.2:72738..73466 (- strand)
Length: 729
gbkey: Gene
gene: SPO0071
gene_biotype: protein_coding
load_id: gene-SPO0071
locus_tag: SPO0071
Parts:
Type: CDS
Description: identified by similarity to GB:AAK22815.1
Source: Genbank
Position: CP000031.2:72738..73466 (- strand)
Length: 729
"ID: cds-AAV93402.1
Dbxref: NCBI_GP:AAV93402.1
IMG: SPO0071: competence protein F
  putative
Note: identified by similarity to GB:AAK22815.1
RefSeq: SPO_RS00360: ComF family protein"
gbkey: CDS
gene: SPO0071
locus_tag: SPO0071
parent_id: gene-SPO0071
product: competence protein F
  putative
protein_id: AAV93402.1
transl_table: 11
translation: MWQQIQTAIETVYPPRCLGCGDLVTSDFGLCGKCWRDTPFIDGTVCDSCGAPLPGARDGH RIECDDCMAHPRPWSDGRAALLYTGRARRMVLALKHGDRPELARPGGLWMARAAAPLLQP NMLIAPVPLHWSRLLRRRYNQSALLAQSVGRQTGLPVCPDLLVRDRATPMLEGMSMTERA KTLSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQACLNAGADQVFVLVLARVTR EA
>SPO0071 class=Sequence position=CP000031.2:72738..73466 (- strand)
ATGTGGCAAC AGATTCAAAC CGCGATCGAA ACGGTCTATC CGCCGCGCTG CCTGGGTTGC GGCGATCTGG TAACATCCGA
TTTCGGCCTG TGCGGCAAAT GCTGGCGCGA CACGCCCTTT ATCGACGGCA CCGTCTGCGA CAGTTGCGGC GCCCCCCTGC
CCGGCGCCCG TGACGGGCAC CGGATTGAAT GCGACGACTG CATGGCCCAT CCGCGCCCCT GGTCGGACGG GCGCGCGGCG
CTGCTCTATA CCGGGCGGGC CCGGCGCATG GTTCTGGCGC TGAAACATGG CGACCGACCC GAACTGGCCC GGCCCGGCGG
GCTGTGGATG GCCCGCGCGG CCGCGCCTCT GTTGCAGCCC AACATGCTGA TCGCGCCGGT GCCGTTGCAT TGGTCCCGCC
TGTTGCGCCG CCGCTACAAC CAGTCCGCCC TGCTGGCGCA AAGCGTCGGG CGCCAGACCG GTCTGCCGGT CTGCCCCGAC
CTTCTGGTTC GCGATCGCGC CACACCGATG CTCGAAGGGA TGAGCATGAC AGAGCGGGCC AAGACCCTGA GCGGTGCGAT
TTCGGTTCAT CCAAAGCGCC GGCACCGGCT GACCGCGCGC AAACTGCTGC TGATCGACGA TGTGATGACC TCGGGCGCGA
CCCTGGCGGC CTCGGCGCAG GCCTGTCTGA ACGCGGGCGC TGATCAAGTT TTCGTTCTGG TACTGGCGCG GGTCACCCGC
GAGGCTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7