Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0071
Type: gene
Description:
Source: GenBank
Position: DSS3:72738..73466 (- strand)
Length: 729
Dbxref: GeneID:3194872
load_id: SPO0071
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:72738..73466 (- strand)
Length: 729
load_id: SPO0071.t01
parent_id: SPO0071
Parts:
Type: CDS
Description: identified by similarity to GB:AAK22815.1; NCBI:competence protein ComF; IMG:Predicted amidophosphoribosyltransferases
Source: GenBank
Position: DSS3:72738..73466 (- strand)
Length: 729
Dbxref: GI:56694999
  GeneID:3194872
Note: identified by similarity to GB:AAK22815.1
  NCBI:competence protein ComF
  IMG:Predicted amidophosphoribosyltransferases
codon_start: 1
load_id: SPO0071.p01
parent_id: SPO0071.t01
product: competence protein F, putative
protein_id: REF_tigr:SPO0071
  YP_165345.1
transl_table: 11
translation: MWQQIQTAIETVYPPRCLGCGDLVTSDFGLCGKCWRDTPFIDGTVCDSCGAPLPGARDGH RIECDDCMAHPRPWSDGRAALLYTGRARRMVLALKHGDRPELARPGGLWMARAAAPLLQP NMLIAPVPLHWSRLLRRRYNQSALLAQSVGRQTGLPVCPDLLVRDRATPMLEGMSMTERA KTLSGAISVHPKRRHRLTARKLLLIDDVMTSGATLAASAQACLNAGADQVFVLVLARVTR EA
Type: exon
Description:
Source: GenBank
Position: DSS3:72738..73466 (- strand)
Length: 729
parent_id: SPO0071.t01
> class=Sequence position=DSS3:72738..73466 (- strand)
ATGTGGCAAC AGATTCAAAC CGCGATCGAA ACGGTCTATC CGCCGCGCTG CCTGGGTTGC GGCGATCTGG TAACATCCGA
TTTCGGCCTG TGCGGCAAAT GCTGGCGCGA CACGCCCTTT ATCGACGGCA CCGTCTGCGA CAGTTGCGGC GCCCCCCTGC
CCGGCGCCCG TGACGGGCAC CGGATTGAAT GCGACGACTG CATGGCCCAT CCGCGCCCCT GGTCGGACGG GCGCGCGGCG
CTGCTCTATA CCGGGCGGGC CCGGCGCATG GTTCTGGCGC TGAAACATGG CGACCGACCC GAACTGGCCC GGCCCGGCGG
GCTGTGGATG GCCCGCGCGG CCGCGCCTCT GTTGCAGCCC AACATGCTGA TCGCGCCGGT GCCGTTGCAT TGGTCCCGCC
TGTTGCGCCG CCGCTACAAC CAGTCCGCCC TGCTGGCGCA AAGCGTCGGG CGCCAGACCG GTCTGCCGGT CTGCCCCGAC
CTTCTGGTTC GCGATCGCGC CACACCGATG CTCGAAGGGA TGAGCATGAC AGAGCGGGCC AAGACCCTGA GCGGTGCGAT
TTCGGTTCAT CCAAAGCGCC GGCACCGGCT GACCGCGCGC AAACTGCTGC TGATCGACGA TGTGATGACC TCGGGCGCGA
CCCTGGCGGC CTCGGCGCAG GCCTGTCTGA ACGCGGGCGC TGATCAAGTT TTCGTTCTGG TACTGGCGCG GGTCACCCGC
GAGGCTTAG
>SPO0071 class=Sequence position=DSS3:72738..73466 (- strand)
ATGTGGCAAC AGATTCAAAC CGCGATCGAA ACGGTCTATC CGCCGCGCTG CCTGGGTTGC GGCGATCTGG TAACATCCGA
TTTCGGCCTG TGCGGCAAAT GCTGGCGCGA CACGCCCTTT ATCGACGGCA CCGTCTGCGA CAGTTGCGGC GCCCCCCTGC
CCGGCGCCCG TGACGGGCAC CGGATTGAAT GCGACGACTG CATGGCCCAT CCGCGCCCCT GGTCGGACGG GCGCGCGGCG
CTGCTCTATA CCGGGCGGGC CCGGCGCATG GTTCTGGCGC TGAAACATGG CGACCGACCC GAACTGGCCC GGCCCGGCGG
GCTGTGGATG GCCCGCGCGG CCGCGCCTCT GTTGCAGCCC AACATGCTGA TCGCGCCGGT GCCGTTGCAT TGGTCCCGCC
TGTTGCGCCG CCGCTACAAC CAGTCCGCCC TGCTGGCGCA AAGCGTCGGG CGCCAGACCG GTCTGCCGGT CTGCCCCGAC
CTTCTGGTTC GCGATCGCGC CACACCGATG CTCGAAGGGA TGAGCATGAC AGAGCGGGCC AAGACCCTGA GCGGTGCGAT
TTCGGTTCAT CCAAAGCGCC GGCACCGGCT GACCGCGCGC AAACTGCTGC TGATCGACGA TGTGATGACC TCGGGCGCGA
CCCTGGCGGC CTCGGCGCAG GCCTGTCTGA ACGCGGGCGC TGATCAAGTT TTCGTTCTGG TACTGGCGCG GGTCACCCGC
GAGGCTTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7