Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0072
Type: gene
Description:
Source: GenBank
Position: DSS3:73483..74316 (+ strand)
Length: 834
Dbxref: GeneID:3194699
load_id: SPO0072
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:73483..74316 (+ strand)
Length: 834
load_id: SPO0072.t01
parent_id: SPO0072
Parts:
Type: CDS
Description: identified by similarity to GB:CAE26039.1; NCBI:SAM-dependent methyltransferase; IMG:Methyltransferase domain-containing protein
Source: GenBank
Position: DSS3:73483..74316 (+ strand)
Length: 834
Dbxref: GI:56695000
  GeneID:3194699
Note: identified by similarity to GB:CAE26039.1
  NCBI:SAM-dependent methyltransferase
  IMG:Methyltransferase domain-containing protein
codon_start: 1
load_id: SPO0072.p01
parent_id: SPO0072.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0072
  YP_165346.1
transl_table: 11
translation: MTTPGSSLPPALVDRTALAARRARMRDAALFLHHAALDEVQDRLSLVNRTFTDMAVVTPA PALWAGSFPMARFVAEDEMLDLAPQSCDLVVHAMALHWANDAVGQLIQCRRALRPDGLLL AICFGGQTLHQLRAALAEAEAQVSGGISPRVAPMAEIRDLGALLQRAGLALPVADSLTLT AEYRDLPHLMRDLRQMGEANALSARLRHPTQRAVFERAEEIYAAHFATPDNRLPATFELI CLTGWAPDDSQPKPLRPGSASARLAAALGTSETPLPD
Type: exon
Description:
Source: GenBank
Position: DSS3:73483..74316 (+ strand)
Length: 834
parent_id: SPO0072.t01
> class=Sequence position=DSS3:73483..74316 (+ strand)
ATGACGACAC CCGGTTCCTC TCTGCCCCCC GCGCTGGTCG ATCGCACCGC ATTGGCCGCA CGCCGTGCCC GGATGAGGGA
CGCGGCGCTG TTCCTGCACC ACGCCGCGCT GGACGAGGTA CAGGATCGCC TGTCTTTGGT TAACAGAACC TTTACGGACA
TGGCGGTGGT GACCCCGGCA CCGGCGCTCT GGGCAGGGTC CTTCCCGATG GCCCGGTTCG TGGCTGAGGA TGAGATGCTC
GACCTGGCCC CGCAAAGCTG CGATCTGGTC GTGCATGCCA TGGCGCTGCA CTGGGCCAAC GACGCGGTGG GGCAACTGAT
ACAGTGCCGG CGCGCGCTCA GGCCCGACGG GCTGCTGTTG GCGATCTGCT TTGGCGGTCA GACCCTGCAT CAACTGCGCG
CGGCGCTGGC CGAGGCCGAG GCCCAGGTGT CCGGCGGCAT CAGCCCCCGA GTTGCGCCGA TGGCCGAGAT TCGTGACCTC
GGCGCGCTGC TTCAGCGGGC GGGACTGGCG CTGCCGGTGG CCGACAGCCT GACGCTCACC GCCGAATACC GCGATCTGCC
GCACCTGATG CGGGACCTGC GCCAGATGGG CGAGGCCAAT GCCCTGTCCG CACGGCTGCG CCACCCAACG CAGCGCGCGG
TGTTCGAGCG CGCCGAAGAG ATCTATGCCG CCCATTTCGC CACGCCCGAT AACCGCCTGC CCGCCACGTT CGAGCTGATC
TGCCTGACTG GCTGGGCACC GGATGACAGC CAGCCCAAAC CGTTGCGCCC GGGATCGGCC AGCGCCCGGC TGGCGGCGGC
TCTGGGCACA TCGGAAACGC CCTTGCCCGA TTGA
>SPO0072 class=Sequence position=DSS3:73483..74316 (+ strand)
ATGACGACAC CCGGTTCCTC TCTGCCCCCC GCGCTGGTCG ATCGCACCGC ATTGGCCGCA CGCCGTGCCC GGATGAGGGA
CGCGGCGCTG TTCCTGCACC ACGCCGCGCT GGACGAGGTA CAGGATCGCC TGTCTTTGGT TAACAGAACC TTTACGGACA
TGGCGGTGGT GACCCCGGCA CCGGCGCTCT GGGCAGGGTC CTTCCCGATG GCCCGGTTCG TGGCTGAGGA TGAGATGCTC
GACCTGGCCC CGCAAAGCTG CGATCTGGTC GTGCATGCCA TGGCGCTGCA CTGGGCCAAC GACGCGGTGG GGCAACTGAT
ACAGTGCCGG CGCGCGCTCA GGCCCGACGG GCTGCTGTTG GCGATCTGCT TTGGCGGTCA GACCCTGCAT CAACTGCGCG
CGGCGCTGGC CGAGGCCGAG GCCCAGGTGT CCGGCGGCAT CAGCCCCCGA GTTGCGCCGA TGGCCGAGAT TCGTGACCTC
GGCGCGCTGC TTCAGCGGGC GGGACTGGCG CTGCCGGTGG CCGACAGCCT GACGCTCACC GCCGAATACC GCGATCTGCC
GCACCTGATG CGGGACCTGC GCCAGATGGG CGAGGCCAAT GCCCTGTCCG CACGGCTGCG CCACCCAACG CAGCGCGCGG
TGTTCGAGCG CGCCGAAGAG ATCTATGCCG CCCATTTCGC CACGCCCGAT AACCGCCTGC CCGCCACGTT CGAGCTGATC
TGCCTGACTG GCTGGGCACC GGATGACAGC CAGCCCAAAC CGTTGCGCCC GGGATCGGCC AGCGCCCGGC TGGCGGCGGC
TCTGGGCACA TCGGAAACGC CCTTGCCCGA TTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7