Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0075
Type: CDS
Description: identified by match to protein family HMM PF03734
Source: Genbank
Position: CP000031.2:75848..76474 (- strand)
Length: 627
"ID: cds-AAV93406.1
Dbxref: NCBI_GP:AAV93406.1
IMG: SPO0075: ErfK/YbiS/YcfS/YnhG family protein/Tat domain protein
Note: identified by match to protein family HMM PF03734
RefSeq: SPO_RS00380: L
  D-transpeptidase"
gbkey: CDS
gene: SPO0075
locus_tag: SPO0075
parent_id: gene-SPO0075
product: ErfK/YbiS/YcfS/YnhG family protein/Tat domain protein
protein_id: AAV93406.1
transl_table: 11
translation: MNFCVKVLLMVKKPTTLSTRRSFLVGAATALGTPALAQFTPEDPLRPAPEPEAPVRRNTS SFRALDWRPYFSNTRNGAILVDTVSRALHYWSEDQSVYRLFPSSVPLTDELTRRGRTSVI RKVVGPSWAPTPSMKKRNPEWPDYIPPGPDNPLGTHALYLSWKYYRIHGTHDTRKIGRRS SNGCIGLYNEHISQLFDLTKVGTQVLLI
>SPO0075 class=Sequence position=CP000031.2:75848..76474 (- strand)
GTGAATTTCT GCGTAAAGGT CCTTTTGATG GTCAAGAAAC CCACCACCCT TTCGACCCGG CGTAGCTTTC TTGTCGGTGC
CGCCACAGCG CTCGGCACCC CTGCGCTGGC CCAATTCACC CCCGAAGACC CCCTGCGCCC CGCGCCCGAG CCCGAGGCAC
CGGTCCGTCG CAACACCTCC AGCTTCCGCG CGCTGGATTG GCGGCCCTAT TTCTCGAACA CCCGCAATGG CGCCATCCTG
GTCGATACCG TCTCGCGGGC GCTGCACTAT TGGTCCGAGG ATCAGAGCGT CTATCGGCTG TTCCCCTCGT CGGTGCCACT
GACCGACGAG CTGACCCGCC GTGGCCGCAC CAGCGTGATT CGCAAGGTCG TCGGCCCCAG CTGGGCCCCG ACCCCGTCGA
TGAAGAAGCG CAATCCCGAA TGGCCCGACT ACATTCCGCC GGGTCCGGAC AACCCGCTGG GCACCCATGC GCTGTATCTC
AGCTGGAAAT ACTACCGCAT CCACGGAACC CACGATACGC GCAAGATCGG CCGCAGATCA TCCAACGGCT GCATCGGTCT
TTACAACGAG CATATCTCGC AGCTGTTCGA TCTGACCAAA GTTGGCACGC AGGTGTTGCT AATTTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7