Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0076
Type: gene
Description:
Source: Genbank
Position: CP000031.2:76609..77127 (+ strand)
Length: 519
gbkey: Gene
gene: SPO0076
gene_biotype: protein_coding
load_id: gene-SPO0076
locus_tag: SPO0076
Parts:
Type: CDS
Description:
Source: Genbank
Position: CP000031.2:76609..77127 (+ strand)
Length: 519
"ID: cds-AAV93407.1
Dbxref: NCBI_GP:AAV93407.1
IMG:
RefSeq: SPO_RS00385: CAP domain-containing protein"
gbkey: CDS
gene: SPO0076
locus_tag: SPO0076
parent_id: gene-SPO0076
product: lipoprotein
  putative
protein_id: AAV93407.1
transl_table: 11
translation: MTMTRLISLLLAGFLALAACTDTGGSGQLGSDGKPLPKVYRIRGDASKLQFRMLDSVNAL RQASGLGVVQLSPELNAAAATHARDMSVQNRPWHFGSDGSSPIDRARRAGYTGIFLGEAI SETYETEVETLAAWMEEPGSRSVILDPKAIMMGFAWFQENNGKIWWALEMGS
>SPO0076 class=Sequence position=CP000031.2:76609..77127 (+ strand)
GTGACCATGA CACGACTGAT TTCCCTTCTC CTTGCCGGCT TTCTGGCGCT GGCCGCCTGT ACCGATACCG GAGGGTCTGG
GCAGCTTGGC TCGGACGGCA AACCTTTGCC CAAGGTCTAC CGGATTCGGG GTGATGCCTC GAAACTGCAG TTCAGAATGC
TTGATTCGGT CAACGCGCTG CGCCAGGCCT CGGGTCTGGG TGTCGTGCAG CTCAGCCCCG AGCTGAACGC CGCCGCAGCC
ACTCATGCCC GCGACATGTC GGTGCAGAAC CGGCCCTGGC ATTTCGGTTC GGACGGGTCC TCGCCGATCG ATCGTGCCCG
CCGTGCCGGA TATACCGGCA TCTTCCTGGG CGAGGCGATC TCGGAGACTT ACGAGACCGA GGTCGAGACC CTGGCCGCCT
GGATGGAAGA GCCGGGCTCG CGGTCGGTCA TCCTCGACCC CAAGGCGATC ATGATGGGCT TTGCCTGGTT CCAGGAGAAC
AACGGCAAGA TCTGGTGGGC GCTGGAAATG GGGTCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7