Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0076
Type: CDS
Description: NCBI:lipoprotein; IMG:Cysteine-rich secretory protein family protein
Source: GenBank
Position: DSS3:76609..77127 (+ strand)
Length: 519
Dbxref: GI:56695004
  GeneID:3195730
Note: NCBI:lipoprotein
  IMG:Cysteine-rich secretory protein family protein
codon_start: 1
load_id: SPO0076.p01
parent_id: SPO0076.t01
product: lipoprotein, putative
protein_id: REF_tigr:SPO0076
  YP_165350.1
transl_table: 11
translation: MTMTRLISLLLAGFLALAACTDTGGSGQLGSDGKPLPKVYRIRGDASKLQFRMLDSVNAL RQASGLGVVQLSPELNAAAATHARDMSVQNRPWHFGSDGSSPIDRARRAGYTGIFLGEAI SETYETEVETLAAWMEEPGSRSVILDPKAIMMGFAWFQENNGKIWWALEMGS
>SPO0076 class=Sequence position=DSS3:76609..77127 (+ strand)
GTGACCATGA CACGACTGAT TTCCCTTCTC CTTGCCGGCT TTCTGGCGCT GGCCGCCTGT ACCGATACCG GAGGGTCTGG
GCAGCTTGGC TCGGACGGCA AACCTTTGCC CAAGGTCTAC CGGATTCGGG GTGATGCCTC GAAACTGCAG TTCAGAATGC
TTGATTCGGT CAACGCGCTG CGCCAGGCCT CGGGTCTGGG TGTCGTGCAG CTCAGCCCCG AGCTGAACGC CGCCGCAGCC
ACTCATGCCC GCGACATGTC GGTGCAGAAC CGGCCCTGGC ATTTCGGTTC GGACGGGTCC TCGCCGATCG ATCGTGCCCG
CCGTGCCGGA TATACCGGCA TCTTCCTGGG CGAGGCGATC TCGGAGACTT ACGAGACCGA GGTCGAGACC CTGGCCGCCT
GGATGGAAGA GCCGGGCTCG CGGTCGGTCA TCCTCGACCC CAAGGCGATC ATGATGGGCT TTGCCTGGTT CCAGGAGAAC
AACGGCAAGA TCTGGTGGGC GCTGGAAATG GGGTCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7