Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0078
Type: gene
Description:
Source: Genbank
Position: CP000031.2:77723..78286 (- strand)
Length: 564
gbkey: Gene
gene: SPO0078
gene_biotype: protein_coding
load_id: gene-SPO0078
locus_tag: SPO0078
Parts:
Type: CDS
Description: identified by match to protein family HMM PF02482; match to protein family HMM TIGR00741
Source: Genbank
Position: CP000031.2:77723..78286 (- strand)
Length: 564
"ID: cds-AAV93409.1
Dbxref: NCBI_GP:AAV93409.1
IMG: SPO0078: SSU ribosomal protein S30P/sigma 54 modulation protein
Note: identified by match to protein family HMM PF02482; match to protein family HMM TIGR00741
RefSeq: SPO_RS00395: raiA: ribosome-associated translation inhibitor RaiA"
gbkey: CDS
gene: SPO0078
locus_tag: SPO0078
parent_id: gene-SPO0078
product: ribosomal subunit interface protein
  putative
protein_id: AAV93409.1
transl_table: 11
translation: MRYQISGKQIDIGAALQSHVQTELGEVVSKYAQRPTDAHVVFSRSAHEYVCEATVHLSTG LTAQAKAHATEIYAAFDGCCEKMDKQLRRYKRRLKDHHKDRAEPVELFGASSYILASEEP DAQSEPDSLQPMIVAEMETKIPSLSVGEAVMQMELAGAPVLVFRNESKDGLNVVYRREDG NIGWIDP
>SPO0078 class=Sequence position=CP000031.2:77723..78286 (- strand)
ATGCGTTATC AAATCAGCGG AAAACAGATC GACATCGGTG CTGCCCTGCA AAGTCATGTT CAGACCGAGC TGGGCGAGGT
GGTGTCGAAA TATGCGCAGC GTCCGACCGA CGCTCATGTC GTGTTTTCCC GTTCGGCGCA TGAATATGTA TGCGAAGCCA
CCGTGCATCT GTCGACCGGT CTGACCGCCC AGGCCAAGGC GCATGCGACC GAGATCTATG CCGCCTTCGA TGGGTGCTGC
GAGAAGATGG ACAAGCAGTT GCGGCGCTAC AAGCGGCGGC TGAAGGACCA CCACAAGGAC CGGGCCGAGC CGGTTGAACT
CTTCGGAGCC TCGTCTTATA TCCTCGCTTC TGAAGAACCG GACGCGCAAA GCGAGCCCGA CTCGCTGCAA CCGATGATCG
TCGCCGAGAT GGAGACCAAG ATTCCATCGC TGTCAGTGGG TGAAGCCGTG ATGCAGATGG AACTGGCTGG CGCCCCGGTG
CTGGTATTTC GGAATGAAAG CAAGGACGGA TTGAACGTCG TGTATCGCCG CGAAGACGGC AATATCGGCT GGATCGATCC
GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7