Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0078
Type: CDS
Description: identified by match to protein family HMM PF02482; match to protein family HMM TIGR00741; NCBI:ribose ABC transporter permease; IMG:sigma 54 modulation protein /SSU ribosomal protein S30P
Source: GenBank
Position: DSS3:77723..78286 (- strand)
Length: 564
Dbxref: GI:56695006
  GeneID:3194769
Note: identified by match to protein family HMM PF02482; match to protein family HMM TIGR00741
  NCBI:ribose ABC transporter permease
  IMG:sigma 54 modulation protein /SSU ribosomal protein S30P
codon_start: 1
load_id: SPO0078.p01
parent_id: SPO0078.t01
product: ribosomal subunit interface protein, putative
protein_id: REF_tigr:SPO0078
  YP_165352.1
transl_table: 11
translation: MRYQISGKQIDIGAALQSHVQTELGEVVSKYAQRPTDAHVVFSRSAHEYVCEATVHLSTG LTAQAKAHATEIYAAFDGCCEKMDKQLRRYKRRLKDHHKDRAEPVELFGASSYILASEEP DAQSEPDSLQPMIVAEMETKIPSLSVGEAVMQMELAGAPVLVFRNESKDGLNVVYRREDG NIGWIDP
>SPO0078 class=Sequence position=DSS3:77723..78286 (- strand)
ATGCGTTATC AAATCAGCGG AAAACAGATC GACATCGGTG CTGCCCTGCA AAGTCATGTT CAGACCGAGC TGGGCGAGGT
GGTGTCGAAA TATGCGCAGC GTCCGACCGA CGCTCATGTC GTGTTTTCCC GTTCGGCGCA TGAATATGTA TGCGAAGCCA
CCGTGCATCT GTCGACCGGT CTGACCGCCC AGGCCAAGGC GCATGCGACC GAGATCTATG CCGCCTTCGA TGGGTGCTGC
GAGAAGATGG ACAAGCAGTT GCGGCGCTAC AAGCGGCGGC TGAAGGACCA CCACAAGGAC CGGGCCGAGC CGGTTGAACT
CTTCGGAGCC TCGTCTTATA TCCTCGCTTC TGAAGAACCG GACGCGCAAA GCGAGCCCGA CTCGCTGCAA CCGATGATCG
TCGCCGAGAT GGAGACCAAG ATTCCATCGC TGTCAGTGGG TGAAGCCGTG ATGCAGATGG AACTGGCTGG CGCCCCGGTG
CTGGTATTTC GGAATGAAAG CAAGGACGGA TTGAACGTCG TGTATCGCCG CGAAGACGGC AATATCGGCT GGATCGATCC
GTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7