Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0079
Type: gene
Description:
Source: Genbank
Position: CP000031.2:78536..79294 (- strand)
Length: 759
gbkey: Gene
gene: SPO0079
gene_biotype: protein_coding
load_id: gene-SPO0079
locus_tag: SPO0079
Parts:
Type: CDS
Description: identified by similarity to GB:AAM48706.1; match to protein family HMM PF00005
Source: Genbank
Position: CP000031.2:78536..79294 (- strand)
Length: 759
"ID: cds-AAV93411.1
Dbxref: NCBI_GP:AAV93411.1
IMG: SPO0079: ABC transporter
  ATP-binding protein
Note: identified by similarity to GB:AAM48706.1; match to protein family HMM PF00005
RefSeq: SPO_RS00400: lptB: LPS export ABC transporter ATP-binding protein"
gbkey: CDS
gene: SPO0079
locus_tag: SPO0079
parent_id: gene-SPO0079
product: ABC transporter
  ATP-binding protein
protein_id: AAV93411.1
transl_table: 11
translation: MSKPQLTVTEGSSGLRIEKLRKSYRKKTVIRDVTMTLGRSEVVALLGPNGSGKTTTFYSV AGLVFPEAGKVSIDGQNVTTLPMYRRARMGIGYLPQEMSIFRGLSVEDNILSVLDITQKH AHKRRERLEELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDP ISVGDIRHLVSDLRNRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGSPEEVVENENV RRVYLGENFRIS
>SPO0079 class=Sequence position=CP000031.2:78536..79294 (- strand)
ATGAGCAAGC CCCAGCTGAC CGTGACCGAG GGATCCTCGG GCCTTCGAAT CGAGAAGTTG CGCAAATCCT ATCGCAAGAA
GACCGTGATC CGCGACGTCA CCATGACGCT TGGCCGATCC GAAGTGGTGG CGCTGCTGGG GCCGAACGGG TCGGGCAAGA
CGACCACGTT CTATTCGGTC GCCGGGCTGG TCTTTCCCGA GGCCGGCAAG GTCAGCATCG ACGGCCAGAA CGTGACCACC
CTGCCGATGT ATCGCCGCGC CCGGATGGGG ATCGGCTATT TGCCGCAGGA AATGTCGATT TTTCGCGGTC TCAGCGTCGA
GGACAACATC CTGTCGGTTC TCGATATCAC CCAGAAACAC GCCCACAAGC GGCGTGAGCG GCTCGAAGAG CTGCTGTCGG
ATTTCTCGAT CGAACACCTG CGCCGCGCCC CGGCGCTGGC GCTGTCGGGT GGCGAGCGCC GCCGGGTCGA GATTGCCCGC
TGCCTGGCCG CCGATCCGAA ATACCTGCTG CTTGACGAAC CCTTTGCCGG GGTCGACCCG ATCAGCGTCG GCGACATCCG
CCACCTTGTC TCGGATCTCA GGAATCGGGG CATCGGCGTG CTGATCACCG ATCACAACGT GCGCGAAACG CTCGAGATCG
TCGACCGCGC CTATATCCTG CATGACGGGC AGGTGCTGAT GTCGGGCAGC CCCGAGGAAG TGGTCGAGAA CGAGAATGTC
CGCCGCGTCT ATCTGGGCGA GAACTTCCGC ATCTCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7