Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0157
Type: CDS
Description: identified by match to protein family HMM PF05731
Source: Genbank
Position: CP000031.2:174344..176026 (+ strand)
Length: 1683
Dbxref: NCBI_GP:AAV93485.1
IMG:
Note: identified by match to protein family HMM PF05731
RefSeq: SPO_RS00805: TROVE domain-containing protein
gbkey: CDS
gene: SPO0157
load_id: cds-AAV93485.1
locus_tag: SPO0157
parent_id: gene-SPO0157
product: TROVE domain protein
protein_id: AAV93485.1
transl_table: 11
translation: MPNSAISVIYAQKQHTRLISCFSRRFPNPMSQSPRTKEDEREMANKSVFASIKGRLLPKA TTRNAEGAPAYAYSDAHALAQVAVTGTFGGMFYTDPRDELEYVVDLAEAVEPCFLAQAAI YARQSGYMKDMPAVLLAVLARRDPALFRRVFGRVVDNGKMLRTFVQVMRSGQTGRKSLGS APKAMVQNWLNTASDRALLAANIGNDPSLADVIRMVHPKPETKEREALFAWIVGRPCNLA LLPQALQDWLAFKAGAKGPVPDVPFQMLTQLDLTPQHWARIARKGSWQMVRQNLNTFQRH GVFNVAKNVAHVAALLRDPEAIGKARAFPYQLMVAAQNLSADMPREIVEALHDAMEIAVR NVPKIDGQVVVCPDVSGSMTCAVTGYRPGATSVVRHVDVAALVAAAFSRVNRGCQVLPFD FEVRDVRLEPRDTILTNAERLAALGGGGTTCSAPLKWLNDRGRSPDLVVFVSDNQSWVDA RAGGQGTAMLAEWEKVKRRNPKARLVCIDIAPYGTSQVQTREDVLNIGGFSDAVFDQIAG FAAGRTGPDHWVGEIEKIEL
>SPO0157 class=Sequence position=CP000031.2:174344..176026 (+ strand)
TTGCCAAATT CGGCAATATC AGTAATTTAT GCACAAAAAC AACATACTAG ACTGATTTCA TGTTTTTCTC GGCGCTTCCC
GAATCCCATG TCACAAAGTC CTCGTACAAA AGAGGACGAG AGAGAAATGG CGAACAAATC CGTGTTTGCA TCGATCAAGG
GCCGGTTGCT GCCCAAGGCG ACCACCAGGA ACGCCGAAGG CGCACCGGCC TACGCCTATT CCGATGCCCA TGCGTTGGCG
CAGGTTGCCG TGACGGGGAC GTTCGGCGGT ATGTTCTACA CCGACCCTCG GGACGAGCTG GAATATGTCG TCGATCTGGC
CGAAGCGGTC GAGCCGTGCT TTCTGGCCCA GGCCGCGATT TATGCCCGCC AGTCGGGTTA CATGAAGGAC ATGCCCGCAG
TTCTGTTGGC GGTTCTGGCC CGGCGTGATC CGGCCCTGTT CCGTAGGGTC TTTGGCCGTG TGGTCGATAA CGGCAAGATG
CTGCGCACCT TTGTACAGGT CATGCGGTCA GGTCAGACCG GGCGCAAGTC GCTCGGCTCG GCACCCAAGG CGATGGTGCA
GAACTGGCTG AACACCGCGT CCGACCGGGC GCTGCTGGCG GCCAATATCG GCAACGACCC ATCTTTGGCC GACGTGATCC
GCATGGTTCA CCCGAAGCCG GAGACCAAGG AGCGGGAGGC GCTTTTCGCC TGGATCGTCG GGCGGCCCTG CAATCTGGCC
CTGCTGCCGC AGGCGCTGCA GGACTGGCTG GCCTTCAAGG CGGGGGCCAA GGGTCCGGTT CCGGACGTGC CGTTCCAGAT
GCTGACGCAG CTGGACCTGA CGCCGCAGCA TTGGGCGCGG ATCGCGCGCA AGGGCTCGTG GCAGATGGTG CGCCAGAACC
TGAACACGTT TCAGCGTCAC GGGGTTTTCA ACGTGGCAAA GAACGTGGCC CATGTCGCGG CCCTGCTGCG CGATCCGGAA
GCGATCGGCA AGGCGCGTGC CTTTCCCTAC CAGCTGATGG TCGCGGCGCA GAACCTGTCC GCCGATATGC CGCGCGAGAT
TGTCGAGGCG CTGCACGACG CGATGGAAAT CGCGGTTCGC AACGTGCCGA AGATCGACGG TCAGGTCGTG GTGTGCCCGG
ACGTGTCCGG CTCCATGACC TGCGCCGTGA CCGGGTACCG CCCGGGTGCG ACCTCGGTCG TACGGCATGT GGATGTCGCG
GCGCTTGTCG CGGCGGCGTT TAGCCGGGTC AACCGCGGAT GTCAGGTTCT GCCGTTCGAC TTCGAGGTGC GCGATGTGCG
CCTTGAGCCG CGCGACACAA TCCTGACGAA TGCCGAACGT CTGGCGGCCC TTGGCGGCGG CGGGACGACC TGCTCGGCGC
CGCTGAAATG GCTGAACGAT CGCGGCCGGT CTCCGGACCT TGTGGTCTTC GTGTCCGACA ACCAGTCTTG GGTTGATGCA
AGGGCTGGCG GGCAGGGAAC CGCGATGCTG GCGGAGTGGG AGAAGGTCAA GCGCCGGAAC CCGAAGGCCA GACTGGTCTG
CATCGACATC GCGCCCTACG GCACGTCGCA GGTGCAAACG CGCGAGGACG TGCTGAATAT CGGCGGGTTC TCGGATGCGG
TCTTTGACCA GATCGCCGGT TTCGCCGCCG GTCGCACCGG CCCGGACCAC TGGGTTGGCG AGATCGAAAA GATCGAACTG
TGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7