Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0079
Type: gene
Description:
Source: GenBank
Position: DSS3:78536..79294 (- strand)
Length: 759
Dbxref: GeneID:3196351
load_id: SPO0079
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:78536..79294 (- strand)
Length: 759
load_id: SPO0079.t01
parent_id: SPO0079
Parts:
Type: CDS
Description: identified by similarity to GB:AAM48706.1; match to protein family HMM PF00005; NCBI:ABC transporter ATP-binding protein; IMG:lipopolysaccharide export system ATP-binding protein
Source: GenBank
Position: DSS3:78536..79294 (- strand)
Length: 759
Dbxref: GI:56695008
  GeneID:3196351
Note: identified by similarity to GB:AAM48706.1; match to protein family HMM PF00005
  NCBI:ABC transporter ATP-binding protein
  IMG:lipopolysaccharide export system ATP-binding protein
codon_start: 1
load_id: SPO0079.p01
parent_id: SPO0079.t01
product: ABC transporter, ATP-binding protein
protein_id: REF_tigr:SPO0079
  YP_165353.1
transl_table: 11
translation: MSKPQLTVTEGSSGLRIEKLRKSYRKKTVIRDVTMTLGRSEVVALLGPNGSGKTTTFYSV AGLVFPEAGKVSIDGQNVTTLPMYRRARMGIGYLPQEMSIFRGLSVEDNILSVLDITQKH AHKRRERLEELLSDFSIEHLRRAPALALSGGERRRVEIARCLAADPKYLLLDEPFAGVDP ISVGDIRHLVSDLRNRGIGVLITDHNVRETLEIVDRAYILHDGQVLMSGSPEEVVENENV RRVYLGENFRIS
Type: exon
Description:
Source: GenBank
Position: DSS3:78536..79294 (- strand)
Length: 759
parent_id: SPO0079.t01
> class=Sequence position=DSS3:78536..79294 (- strand)
ATGAGCAAGC CCCAGCTGAC CGTGACCGAG GGATCCTCGG GCCTTCGAAT CGAGAAGTTG CGCAAATCCT ATCGCAAGAA
GACCGTGATC CGCGACGTCA CCATGACGCT TGGCCGATCC GAAGTGGTGG CGCTGCTGGG GCCGAACGGG TCGGGCAAGA
CGACCACGTT CTATTCGGTC GCCGGGCTGG TCTTTCCCGA GGCCGGCAAG GTCAGCATCG ACGGCCAGAA CGTGACCACC
CTGCCGATGT ATCGCCGCGC CCGGATGGGG ATCGGCTATT TGCCGCAGGA AATGTCGATT TTTCGCGGTC TCAGCGTCGA
GGACAACATC CTGTCGGTTC TCGATATCAC CCAGAAACAC GCCCACAAGC GGCGTGAGCG GCTCGAAGAG CTGCTGTCGG
ATTTCTCGAT CGAACACCTG CGCCGCGCCC CGGCGCTGGC GCTGTCGGGT GGCGAGCGCC GCCGGGTCGA GATTGCCCGC
TGCCTGGCCG CCGATCCGAA ATACCTGCTG CTTGACGAAC CCTTTGCCGG GGTCGACCCG ATCAGCGTCG GCGACATCCG
CCACCTTGTC TCGGATCTCA GGAATCGGGG CATCGGCGTG CTGATCACCG ATCACAACGT GCGCGAAACG CTCGAGATCG
TCGACCGCGC CTATATCCTG CATGACGGGC AGGTGCTGAT GTCGGGCAGC CCCGAGGAAG TGGTCGAGAA CGAGAATGTC
CGCCGCGTCT ATCTGGGCGA GAACTTCCGC ATCTCCTGA
>SPO0079 class=Sequence position=DSS3:78536..79294 (- strand)
ATGAGCAAGC CCCAGCTGAC CGTGACCGAG GGATCCTCGG GCCTTCGAAT CGAGAAGTTG CGCAAATCCT ATCGCAAGAA
GACCGTGATC CGCGACGTCA CCATGACGCT TGGCCGATCC GAAGTGGTGG CGCTGCTGGG GCCGAACGGG TCGGGCAAGA
CGACCACGTT CTATTCGGTC GCCGGGCTGG TCTTTCCCGA GGCCGGCAAG GTCAGCATCG ACGGCCAGAA CGTGACCACC
CTGCCGATGT ATCGCCGCGC CCGGATGGGG ATCGGCTATT TGCCGCAGGA AATGTCGATT TTTCGCGGTC TCAGCGTCGA
GGACAACATC CTGTCGGTTC TCGATATCAC CCAGAAACAC GCCCACAAGC GGCGTGAGCG GCTCGAAGAG CTGCTGTCGG
ATTTCTCGAT CGAACACCTG CGCCGCGCCC CGGCGCTGGC GCTGTCGGGT GGCGAGCGCC GCCGGGTCGA GATTGCCCGC
TGCCTGGCCG CCGATCCGAA ATACCTGCTG CTTGACGAAC CCTTTGCCGG GGTCGACCCG ATCAGCGTCG GCGACATCCG
CCACCTTGTC TCGGATCTCA GGAATCGGGG CATCGGCGTG CTGATCACCG ATCACAACGT GCGCGAAACG CTCGAGATCG
TCGACCGCGC CTATATCCTG CATGACGGGC AGGTGCTGAT GTCGGGCAGC CCCGAGGAAG TGGTCGAGAA CGAGAATGTC
CGCCGCGTCT ATCTGGGCGA GAACTTCCGC ATCTCCTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7