Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0080
Type: gene
Description:
Source: Genbank
Position: CP000031.2:79294..79785 (- strand)
Length: 492
gbkey: Gene
gene: SPO0080
gene_biotype: protein_coding
load_id: gene-SPO0080
locus_tag: SPO0080
Parts:
Type: CDS
Description: identified by match to protein family HMM PF03968
Source: Genbank
Position: CP000031.2:79294..79785 (- strand)
Length: 492
Dbxref: NCBI_GP:AAV93410.1
IMG: SPO0080: lipopolysaccharide export system protein LptA
Note: identified by match to protein family HMM PF03968
RefSeq: SPO_RS00405: organic solvent tolerance protein OstA
gbkey: CDS
gene: SPO0080
load_id: cds-AAV93410.1
locus_tag: SPO0080
parent_id: gene-SPO0080
product: hypothetical protein
protein_id: AAV93410.1
transl_table: 11
translation: MIEIRALILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTADSLDVSQEDGSAEFQG NVLVSQGEMRLSAKRVLVIYNQEASGIERLEATGDVVLVSGSDAAQAQRADYTIGTGVIV MTGDVLLTQGKNALSSGKMTVNLTSGTAQMVGRVKTILNSGSD
>SPO0080 class=Sequence position=CP000031.2:79294..79785 (- strand)
GTGATCGAAA TTCGTGCATT GATCCTGGGC CTCGTCCTTG CCCTTGGTGC CGTTGCGGCC CAGGCCGAGG GCACCAAGGT
TGCATTCGGC GCGGTCAAGG CCGACCCGAC GCTGCCGGTC GAGGTGACCG CCGACAGTCT GGATGTGAGC CAGGAGGACG
GCTCGGCCGA GTTCCAGGGC AATGTGCTGG TCTCGCAGGG CGAGATGCGT CTGTCGGCCA AACGGGTGCT GGTGATCTAC
AATCAGGAGG CCTCGGGGAT CGAACGGCTG GAGGCAACCG GCGACGTGGT GCTGGTCAGC GGGTCCGACG CCGCCCAGGC
CCAGCGCGCC GATTACACCA TCGGCACCGG TGTCATCGTG ATGACCGGCG ATGTCCTGCT GACCCAGGGC AAGAATGCGC
TGAGCTCGGG CAAGATGACC GTCAACCTGA CCTCGGGCAC CGCCCAGATG GTCGGGCGGG TGAAAACCAT CCTCAACTCG
GGCAGCGACT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7