Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0080
Type: CDS
Description: identified by match to protein family HMM PF03968; NCBI:organic solvent tolerance protein OstA; IMG:lipopolysaccharide export system protein LptA
Source: GenBank
Position: DSS3:79294..79785 (- strand)
Length: 492
Dbxref: GI:56695007
  GeneID:3195158
Note: identified by match to protein family HMM PF03968
  NCBI:organic solvent tolerance protein OstA
  IMG:lipopolysaccharide export system protein LptA
codon_start: 1
load_id: SPO0080.p01
parent_id: SPO0080.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0080
  YP_165354.1
transl_table: 11
translation: MIEIRALILGLVLALGAVAAQAEGTKVAFGAVKADPTLPVEVTADSLDVSQEDGSAEFQG NVLVSQGEMRLSAKRVLVIYNQEASGIERLEATGDVVLVSGSDAAQAQRADYTIGTGVIV MTGDVLLTQGKNALSSGKMTVNLTSGTAQMVGRVKTILNSGSD
>SPO0080 class=Sequence position=DSS3:79294..79785 (- strand)
GTGATCGAAA TTCGTGCATT GATCCTGGGC CTCGTCCTTG CCCTTGGTGC CGTTGCGGCC CAGGCCGAGG GCACCAAGGT
TGCATTCGGC GCGGTCAAGG CCGACCCGAC GCTGCCGGTC GAGGTGACCG CCGACAGTCT GGATGTGAGC CAGGAGGACG
GCTCGGCCGA GTTCCAGGGC AATGTGCTGG TCTCGCAGGG CGAGATGCGT CTGTCGGCCA AACGGGTGCT GGTGATCTAC
AATCAGGAGG CCTCGGGGAT CGAACGGCTG GAGGCAACCG GCGACGTGGT GCTGGTCAGC GGGTCCGACG CCGCCCAGGC
CCAGCGCGCC GATTACACCA TCGGCACCGG TGTCATCGTG ATGACCGGCG ATGTCCTGCT GACCCAGGGC AAGAATGCGC
TGAGCTCGGG CAAGATGACC GTCAACCTGA CCTCGGGCAC CGCCCAGATG GTCGGGCGGG TGAAAACCAT CCTCAACTCG
GGCAGCGACT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7