Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0081
Type: gene
Description:
Source: Genbank
Position: CP000031.2:79789..80397 (- strand)
Length: 609
gbkey: Gene
gene: SPO0081
gene_biotype: protein_coding
load_id: gene-SPO0081
locus_tag: SPO0081
Parts:
Type: CDS
Description: identified by similarity to GB:AAM48708.1
Source: Genbank
Position: CP000031.2:79789..80397 (- strand)
Length: 609
Dbxref: NCBI_GP:AAV93412.1
IMG:
Note: identified by similarity to GB:AAM48708.1
RefSeq: SPO_RS00410: hypothetical protein
gbkey: CDS
gene: SPO0081
load_id: cds-AAV93412.1
locus_tag: SPO0081
parent_id: gene-SPO0081
product: hypothetical protein
protein_id: AAV93412.1
transl_table: 11
translation: MAIDSYSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFAEDEIADRTRGQQITG PFFTAVTPKGEQIQVQATLARPGGENAPAEATDLIAELLLLGGKRIRLTSDLGTVQLDKD LAIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGPIGEFTAGSMQMGAENED GPIHIRFKNGVKLLYDPKAAER
>SPO0081 class=Sequence position=CP000031.2:79789..80397 (- strand)
ATGGCGATCG ACAGCTACTC TCGGGTTGTC CAATACCTCA AGGTGCTGTT GCCCCTTACG GCGCTTGGCC TGCTGTCGGC
CGTGTTCCTG CTGTCGTCGC GCGGCACCGA TTCCGTGGCC CCGATTCCCT TTGCCGAGGA TGAGATCGCC GACCGCACCC
GCGGCCAGCA GATCACCGGC CCGTTCTTTA CGGCAGTCAC CCCCAAGGGC GAGCAGATCC AGGTGCAGGC GACGCTGGCC
CGCCCGGGCG GCGAGAACGC ACCTGCCGAG GCGACCGACC TGATCGCCGA ACTGCTTCTG CTCGGTGGCA AGCGTATCCG
GCTGACCTCG GATCTGGGCA CCGTGCAACT GGACAAGGAT CTGGCGATCT TCACCGGCAA TGTGGTGATC ACGACGTCGG
ACGGGCTGAC GGTGACCACC GATCAGCTCA ACGCAGGGCT GAGCGGAATA TCCGGCGAAA CCCCCGGCAA CGTGCGCGGA
ACCGGACCTA TCGGAGAGTT TACAGCAGGT TCTATGCAAA TGGGGGCTGA AAACGAGGAC GGCCCTATCC ATATTCGTTT
CAAGAATGGC GTGAAGCTGC TATATGACCC CAAAGCTGCG GAAAGATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7