Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0081
Type: CDS
Description: identified by similarity to GB:AAM48708.1; NCBI:hypothetical protein; IMG:lipopolysaccharide export system protein LptC
Source: GenBank
Position: DSS3:79789..80397 (- strand)
Length: 609
Dbxref: GI:56695009
  GeneID:3195608
Note: identified by similarity to GB:AAM48708.1
  NCBI:hypothetical protein
  IMG:lipopolysaccharide export system protein LptC
codon_start: 1
load_id: SPO0081.p01
parent_id: SPO0081.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0081
  YP_165355.1
transl_table: 11
translation: MAIDSYSRVVQYLKVLLPLTALGLLSAVFLLSSRGTDSVAPIPFAEDEIADRTRGQQITG PFFTAVTPKGEQIQVQATLARPGGENAPAEATDLIAELLLLGGKRIRLTSDLGTVQLDKD LAIFTGNVVITTSDGLTVTTDQLNAGLSGISGETPGNVRGTGPIGEFTAGSMQMGAENED GPIHIRFKNGVKLLYDPKAAER
>SPO0081 class=Sequence position=DSS3:79789..80397 (- strand)
ATGGCGATCG ACAGCTACTC TCGGGTTGTC CAATACCTCA AGGTGCTGTT GCCCCTTACG GCGCTTGGCC TGCTGTCGGC
CGTGTTCCTG CTGTCGTCGC GCGGCACCGA TTCCGTGGCC CCGATTCCCT TTGCCGAGGA TGAGATCGCC GACCGCACCC
GCGGCCAGCA GATCACCGGC CCGTTCTTTA CGGCAGTCAC CCCCAAGGGC GAGCAGATCC AGGTGCAGGC GACGCTGGCC
CGCCCGGGCG GCGAGAACGC ACCTGCCGAG GCGACCGACC TGATCGCCGA ACTGCTTCTG CTCGGTGGCA AGCGTATCCG
GCTGACCTCG GATCTGGGCA CCGTGCAACT GGACAAGGAT CTGGCGATCT TCACCGGCAA TGTGGTGATC ACGACGTCGG
ACGGGCTGAC GGTGACCACC GATCAGCTCA ACGCAGGGCT GAGCGGAATA TCCGGCGAAA CCCCCGGCAA CGTGCGCGGA
ACCGGACCTA TCGGAGAGTT TACAGCAGGT TCTATGCAAA TGGGGGCTGA AAACGAGGAC GGCCCTATCC ATATTCGTTT
CAAGAATGGC GTGAAGCTGC TATATGACCC CAAAGCTGCG GAAAGATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7