Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0083
Type: CDS
Description: identified by match to protein family HMM PF01612; NCBI:3'-5' exonuclease; IMG:ribonuclease D
Source: GenBank
Position: DSS3:81366..81980 (- strand)
Length: 615
Dbxref: GI:56695010
  GeneID:3193828
Note: identified by match to protein family HMM PF01612
  NCBI:3'-5' exonuclease
  IMG:ribonuclease D
codon_start: 1
load_id: SPO0083.p01
parent_id: SPO0083.t01
product: exonuclease, putative
protein_id: REF_tigr:SPO0083
  YP_165357.1
transl_table: 11
translation: MANHLYKNDLPDGLDLGPVVAIDCETMGLNPHRDRLCVIQMSGGDGNTHIVQVEKGQTAA PNLCAMLENPEVLKLFHFGRFDIAALYHAFGALTAPVYCTKIASRLVRTYTDRHGLKNLC QELLGVDISKQQQMSDWGAETLSEAQLDYAASDVLYLHRLREALDGRLAREGRADLAQSC FDFLPTRARLDLVGWPETDIFAHS
>SPO0083 class=Sequence position=DSS3:81366..81980 (- strand)
GTGGCAAATC ATCTCTACAA GAACGACCTG CCCGACGGGC TGGATCTGGG CCCCGTGGTG GCCATCGACT GCGAGACCAT
GGGACTGAAC CCCCATCGCG ACCGTCTCTG TGTGATCCAG ATGTCGGGCG GCGACGGAAA CACCCATATC GTGCAGGTAG
AAAAGGGCCA GACCGCCGCG CCCAACCTGT GTGCGATGCT GGAAAACCCC GAGGTGCTGA AACTGTTCCA CTTCGGCCGT
TTCGACATTG CCGCGCTCTA TCACGCCTTT GGCGCCCTGA CCGCACCGGT CTATTGCACC AAGATCGCCA GCCGCCTGGT
GCGCACCTAT ACCGATCGCC ACGGGCTCAA GAACCTGTGC CAGGAGTTGC TGGGCGTCGA TATCTCGAAA CAGCAGCAGA
TGAGCGATTG GGGCGCCGAG ACGCTGAGCG AGGCGCAGCT GGACTATGCC GCCTCCGATG TCCTCTATCT GCACCGCCTG
CGCGAGGCGC TGGATGGCCG GCTGGCGCGC GAAGGCCGCG CCGATCTGGC GCAATCCTGC TTCGATTTCC TGCCTACACG
GGCGCGGCTC GACCTTGTGG GCTGGCCCGA AACCGATATC TTTGCCCACT CATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7