Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0085
Type: gene
Description:
Source: Genbank
Position: CP000031.2:83874..84212 (+ strand)
Length: 339
gbkey: Gene
gene: SPO0085
gene_biotype: protein_coding
load_id: gene-SPO0085
locus_tag: SPO0085
Parts:
Type: CDS
Description: identified by similarity to GB:CAE29577.1
Source: Genbank
Position: CP000031.2:83874..84212 (+ strand)
Length: 339
Dbxref: NCBI_GP:AAV93416.1
IMG:
Note: identified by similarity to GB:CAE29577.1
RefSeq: SPO_RS00430: hypothetical protein
gbkey: CDS
gene: SPO0085
load_id: cds-AAV93416.1
locus_tag: SPO0085
parent_id: gene-SPO0085
product: hypothetical protein
protein_id: AAV93416.1
transl_table: 11
translation: MDAMTQHYDAMPQMGPSNDYHLLPVTEKQLRFARSIAARASLDIPIEAQRDRRMLSAWIS AHRAPESSPFDRYPSGKQVAYAERIARAKRRAVPSECFHDKAAMSAWIDRNK
>SPO0085 class=Sequence position=CP000031.2:83874..84212 (+ strand)
GTGGATGCCA TGACTCAGCA TTACGACGCC ATGCCCCAGA TGGGGCCGAG CAACGATTAT CATCTGCTGC CGGTGACCGA
GAAACAGTTG CGCTTTGCGC GATCGATCGC TGCCCGTGCC TCGCTGGACA TCCCGATCGA GGCGCAGCGC GACCGGCGCA
TGTTGTCGGC TTGGATCTCG GCCCATCGCG CGCCCGAATC CTCTCCCTTC GACCGGTATC CCTCGGGCAA GCAGGTCGCC
TATGCCGAGC GGATCGCACG GGCCAAGCGG CGGGCCGTGC CCTCGGAATG TTTCCACGAC AAGGCGGCGA TGTCGGCCTG
GATCGACCGC AACAAGTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7