Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0086
Type: CDS
Description: identified by similarity to GB:CAC41759.1
Source: Genbank
Position: CP000031.2:84326..85588 (+ strand)
Length: 1263
"ID: cds-AAV93417.1
Dbxref: NCBI_GP:AAV93417.1
IMG: SPO0086: imelysin. Metallo peptidase. MEROPS family M75
Note: identified by similarity to GB:CAC41759.1
RefSeq: SPO_RS00435: peptidase"
gbkey: CDS
gene: SPO0086
locus_tag: SPO0086
parent_id: gene-SPO0086
product: lipoprotein
  putative
protein_id: AAV93417.1
transl_table: 11
translation: MKTRVFAAAALALSCSVPAWAADRAAVLTTYADIAEAKYQDSLITARALQVAVDALIADP SAQTLAAAKQAWLAARDPYQQTEVYRFGNAIVDDWEGKVNAWPLDEGLIDYVDASYPGAS DENGYAALNVIATPVFDLSGTTVDASQITPELLSGTLHEADGVEANVATGYHAIEFLLWG QDLNGTGPGAGNRPWTDYAPGADCTGGNCDRRGAYLQAATDLLISDLEWMAAQWAPGGDA RTSVTADETAGLVAMLTGMGSLSYGEQAGERMRLGLLLNDPEEEHDCFSDNTHNSHYFDG LGIRNVYLGSYTRVDGTVISGASLSDLVADADAALDAEVKDRLNITMDALGAIRSAAKGG FAYDQMLARGNAEGEALIMAGVDGLVEQARSFQRLFPVLGLDDIAFEGSESLDNPGAVFH
>SPO0086 class=Sequence position=CP000031.2:84326..85588 (+ strand)
ATGAAAACCC GTGTCTTCGC CGCTGCGGCG CTGGCTTTGT CGTGTTCCGT GCCCGCCTGG GCTGCCGACC GTGCCGCCGT
TCTGACCACC TATGCCGACA TTGCCGAGGC CAAGTATCAA GACAGCCTGA TCACCGCCCG CGCGCTTCAG GTTGCGGTCG
ATGCGCTGAT CGCCGATCCC TCGGCCCAGA CGCTGGCCGC CGCCAAACAG GCCTGGCTTG CCGCCCGCGA TCCCTATCAG
CAGACCGAGG TTTATCGCTT CGGCAATGCC ATCGTCGATG ATTGGGAGGG CAAGGTGAAT GCCTGGCCGC TGGACGAAGG
GCTGATCGAC TATGTCGATG CCTCCTACCC CGGGGCGAGT GATGAAAACG GCTATGCCGC GCTGAACGTG ATCGCGACGC
CTGTGTTCGA CCTGTCCGGT ACGACCGTCG ACGCCAGCCA GATCACGCCC GAGCTGCTTT CGGGCACCCT GCACGAGGCG
GACGGGGTCG AGGCGAATGT AGCGACCGGT TATCACGCCA TCGAGTTCCT GCTCTGGGGA CAGGATCTGA ACGGCACGGG
CCCGGGCGCG GGCAACCGGC CCTGGACCGA CTACGCGCCC GGTGCCGATT GCACCGGCGG CAATTGCGAC CGGCGTGGCG
CCTATCTGCA GGCGGCGACC GATCTGCTGA TCTCGGATCT GGAATGGATG GCCGCGCAAT GGGCGCCGGG CGGCGACGCC
CGTACCTCGG TCACGGCGGA CGAGACCGCT GGCCTAGTGG CGATGCTGAC CGGCATGGGC AGCCTCAGCT ATGGCGAACA
GGCGGGCGAG CGGATGCGGC TGGGCCTGTT GCTGAACGAT CCCGAGGAAG AGCATGACTG TTTCTCGGAC AACACCCACA
ACAGCCATTA CTTCGACGGG CTGGGTATCC GGAACGTCTA TTTGGGCAGC TATACCCGTG TTGACGGCAC GGTGATCTCG
GGCGCCTCGC TGTCCGATCT GGTGGCTGAT GCCGACGCGG CGCTGGATGC CGAGGTCAAG GACAGGCTCA ACATCACGAT
GGACGCGCTG GGCGCCATCC GCAGCGCCGC CAAGGGCGGG TTCGCCTATG ACCAAATGCT GGCGCGCGGC AATGCCGAAG
GCGAGGCGCT GATCATGGCG GGCGTCGACG GGCTGGTCGA ACAGGCCCGT TCGTTCCAGC GCCTGTTCCC GGTGCTGGGC
CTCGACGACA TCGCTTTCGA AGGCTCGGAG TCGCTCGATA ACCCCGGCGC TGTGTTTCAC TAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7