Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0087
Type: CDS
Description: identified by Glimmer2; putative
Source: Genbank
Position: CP000031.2:85616..86671 (+ strand)
Length: 1056
Dbxref: NCBI_GP:AAV93418.1
IMG:
Note: identified by Glimmer2; putative
RefSeq: SPO_RS00440: hypothetical protein
gbkey: CDS
gene: SPO0087
load_id: cds-AAV93418.1
locus_tag: SPO0087
parent_id: gene-SPO0087
product: hypothetical protein
protein_id: AAV93418.1
transl_table: 11
translation: MPAKLLIQESSIMTYRHFAALTGAAALFAGAVQAQEAPGFTWEGSLELEYARTFKSDTPG NEFGAATGTLELSGAYRFNDTFSVFAALTGESLNDPTPGDRNFTDWGLYIKELGVQIETG SASFQLGKVSPSFGIAWDQTAGFFAADLAEDYELTEQLGALVAVDLGAAGMLHAGLFYAD DTALSRSAGFRRARNSTASGGAGNTGQLDNGAVTWIKSFGGTELRLGVRHLSRGAGDVKS ENGVVASLFHSFHHMPLDLFAEVASFSGYGGTADDATYATLNAAYALGDVTLSGTYARRD IDSTGLTELFSIGAEYEFGERYLVGAALARVEEAGATDHVFGINFEIALGV
>SPO0087 class=Sequence position=CP000031.2:85616..86671 (+ strand)
ATGCCCGCCA AGCTGCTCAT CCAAGAAAGT AGCATCATGA CTTACAGACA TTTCGCGGCG CTGACCGGCG CCGCCGCTCT
CTTTGCGGGC GCAGTGCAGG CGCAAGAAGC GCCCGGCTTC ACCTGGGAAG GTTCGCTGGA GCTGGAATAC GCCCGCACCT
TCAAATCGGA CACGCCGGGC AACGAATTCG GTGCCGCCAC CGGTACGCTG GAGTTGTCGG GGGCCTATCG GTTCAACGAT
ACTTTCAGCG TCTTTGCCGC CCTGACCGGC GAGAGCCTGA ATGACCCCAC CCCCGGCGAC CGGAACTTCA CCGACTGGGG
CCTCTATATC AAGGAACTGG GTGTGCAGAT CGAAACCGGT TCGGCCAGTT TCCAGCTGGG CAAGGTCTCG CCCAGCTTTG
GTATCGCCTG GGATCAGACG GCGGGATTCT TTGCCGCCGA TCTGGCCGAG GATTACGAGC TGACCGAGCA GTTGGGCGCG
CTGGTCGCCG TCGATCTGGG CGCGGCGGGG ATGCTGCATG CGGGCCTTTT CTATGCCGAC GACACCGCGC TGAGCCGGTC
GGCCGGGTTC CGTCGGGCGC GCAATAGCAC TGCGTCGGGT GGCGCGGGCA ATACCGGGCA GCTCGACAAT GGCGCGGTGA
CGTGGATCAA GTCCTTTGGC GGGACCGAAT TGCGACTGGG TGTACGCCAC CTCAGCCGGG GCGCGGGGGA TGTGAAATCG
GAAAACGGGG TGGTGGCCAG CCTGTTTCAT TCCTTTCATC ACATGCCGCT CGACCTGTTT GCCGAGGTCG CCAGCTTCAG
CGGTTATGGC GGTACCGCTG ATGACGCCAC CTATGCAACG CTCAACGCCG CCTATGCGCT GGGCGACGTG ACCCTGTCGG
GCACCTACGC CCGGCGCGAT ATCGACAGCA CCGGGTTGAC CGAACTGTTT TCAATCGGGG CTGAATACGA GTTTGGCGAG
CGCTACCTTG TGGGCGCGGC GTTGGCGCGC GTGGAAGAGG CGGGTGCCAC AGACCATGTC TTCGGGATCA ACTTCGAGAT
CGCATTGGGC GTATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7