Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0088
Type: gene
Description:
Source: Genbank
Position: CP000031.2:86668..88158 (+ strand)
Length: 1491
gbkey: Gene
gene: SPO0088
gene_biotype: protein_coding
load_id: gene-SPO0088
locus_tag: SPO0088
Parts:
Type: CDS
Description: identified by similarity to GB:BAB51963.1
Source: Genbank
Position: CP000031.2:86668..88158 (+ strand)
Length: 1491
Dbxref: NCBI_GP:AAV93419.1
IMG: SPO0088: hypothetical protein
Note: identified by similarity to GB:BAB51963.1
RefSeq: SPO_RS00445: thiol oxidoreductase
gbkey: CDS
gene: SPO0088
load_id: cds-AAV93419.1
locus_tag: SPO0088
parent_id: gene-SPO0088
product: hypothetical protein
protein_id: AAV93419.1
transl_table: 11
translation: MNIWGPHIVQARRAVAIFCRGLLVLMPALSLLGLTAEAEPRSADDRQRIAAVTAPATGFT VAEPFEQLPGGAATVSGDLGRDAFSRPSANMSFERELDFHLGQALFDKLWVASPSSTKAS DGLGPLYNARSCQACHIRDGRGQVSGGPGLVLRIGRVRGDGVLPDPLFGLQIQDSAVPGL RPEARIAVSQAETEVTLNGGEVAVLRKPRYRLDAAEGTLHAESTLSPRLAPQMIGLGLLE AIPEAEILARADPDDRDGDGISGRPNRVHDPETGQEALGRFGWKAGAASVLDQTAAAFAS DIGISSPLRPAPWGDCTELQVECRAALHGDGDPRGAEIDGPALALTAFYSRNLAVPARRD VDDPDVLRGKRVFYGIGCPACHVPKHVTAQLSDQPEQSFQLIWPYTDLLLHDMGAGLADE LPQGLASGREWRTAPLWGIGLTEQVSGQARFLHDGRARTLLEAVLWHGGEAAAQRDRVIA LAPEDRAALIRFLESL
>SPO0088 class=Sequence position=CP000031.2:86668..88158 (+ strand)
ATGAATATTT GGGGGCCTCA TATCGTTCAG GCGCGGCGCG CGGTCGCGAT CTTTTGTCGA GGCCTCCTTG TGTTGATGCC
TGCGCTGTCA CTCCTTGGCC TCACCGCAGA GGCCGAGCCG CGCAGCGCGG ATGACCGCCA GAGGATTGCC GCCGTCACCG
CCCCGGCAAC GGGGTTCACG GTGGCGGAAC CCTTTGAACA GTTGCCCGGT GGCGCCGCCA CGGTATCGGG CGATCTGGGG
CGCGATGCCT TCTCGCGCCC TTCGGCCAAT ATGAGCTTCG AGCGGGAACT GGATTTCCAC CTGGGTCAGG CCCTGTTTGA
CAAGCTGTGG GTGGCGTCAC CCTCCTCGAC CAAGGCATCC GACGGGCTGG GGCCGCTCTA CAATGCGCGC AGCTGTCAGG
CCTGCCATAT CCGCGACGGG CGCGGTCAGG TTTCGGGTGG ACCGGGGCTG GTGCTGCGGA TCGGCAGGGT CCGGGGTGAC
GGGGTGCTGC CCGATCCCCT GTTCGGACTT CAGATACAGG ACAGCGCCGT GCCCGGCCTA CGGCCCGAGG CACGGATCGC
GGTGAGCCAA GCCGAGACCG AGGTCACCCT GAACGGGGGC GAGGTGGCGG TTCTGCGCAA GCCCCGATAC CGGCTGGACG
CGGCCGAGGG CACGCTGCAC GCCGAAAGCA CGCTCAGCCC CCGGCTGGCA CCACAGATGA TCGGGCTGGG CCTGCTCGAA
GCGATCCCCG AGGCCGAAAT CCTGGCCCGT GCCGATCCGG ACGACCGGGA TGGCGATGGC ATATCGGGGC GGCCCAACCG
GGTGCACGAT CCGGAGACCG GGCAAGAGGC GCTGGGCCGG TTCGGGTGGA AGGCTGGCGC GGCCTCGGTC CTGGATCAGA
CCGCCGCTGC CTTCGCCTCG GATATCGGCA TCTCTTCTCC GCTGCGCCCC GCGCCCTGGG GCGATTGCAC CGAATTGCAG
GTGGAATGCC GGGCTGCCCT GCATGGCGAT GGTGATCCGC GCGGCGCCGA GATCGACGGC CCGGCGCTGG CGCTGACCGC
GTTCTACAGC CGCAACCTTG CCGTGCCGGC GCGGCGGGAT GTGGATGACC CCGACGTGTT GCGGGGCAAA CGGGTGTTCT
ATGGCATCGG CTGCCCGGCC TGTCATGTCC CCAAGCATGT GACCGCCCAG CTGAGCGATC AGCCCGAGCA GAGCTTTCAG
CTGATCTGGC CCTATACCGA CCTCTTGCTG CATGACATGG GCGCAGGGCT GGCCGACGAG TTGCCGCAGG GTCTGGCCAG
CGGGCGCGAA TGGCGCACCG CTCCGCTCTG GGGGATTGGC CTGACCGAAC AGGTCAGCGG GCAGGCGCGT TTCCTGCACG
ACGGGCGGGC GCGCACATTG CTTGAAGCGG TGCTTTGGCA CGGGGGCGAG GCTGCGGCGC AGCGCGACCG GGTGATCGCC
CTTGCGCCCG AGGACCGCGC CGCCCTGATC CGGTTTCTGG AGAGTCTCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7