Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0089
Type: CDS
Description: identified by similarity to GB:CAE32220.1
Source: Genbank
Position: CP000031.2:88160..89155 (+ strand)
Length: 996
Dbxref: NCBI_GP:AAV93420.1
IMG: SPO0089: hypothetical protein
Note: identified by similarity to GB:CAE32220.1
RefSeq: SPO_RS00450: imelysin family protein
gbkey: CDS
gene: SPO0089
load_id: cds-AAV93420.1
locus_tag: SPO0089
parent_id: gene-SPO0089
product: hypothetical protein
protein_id: AAV93420.1
transl_table: 11
translation: MKQLVALILCLAAAAASADPVDQVLDVHVLPGFARLADETALLANAADAGCEERDPDLRA ALNGALRAWAGVSHLRFGPTEAENRAFALAFWPDSRGMTPKALAGLIAAEDPVVQEAEGF AQVSVAARGLYALEFLLYDEGQAGNDPYHCALIRAIVRDSAGLARAMAADWHDRYAALMR APGPDSPYRSRDEAMQELFKALGTGLQITADLRLGRPLGSFARPRPNRAEAWRAGLSLLL VIEALHSQRQLALLLAEEDAGLKARLTDAFDRALGDAAALDDPALAGVATPAGRFRVEAL QQRVNEIRQVVAQELGPKLGVSAGFNALDGD
>SPO0089 class=Sequence position=CP000031.2:88160..89155 (+ strand)
ATGAAGCAGC TTGTTGCTCT GATCCTATGC CTTGCCGCCG CGGCAGCATC CGCCGACCCT GTCGATCAGG TGCTCGACGT
CCATGTGTTG CCGGGGTTTG CGCGGCTGGC TGACGAGACA GCGTTGCTGG CCAACGCCGC CGATGCCGGG TGCGAAGAGC
GCGACCCTGA CTTGCGCGCG GCGCTCAACG GCGCGCTGCG CGCCTGGGCC GGGGTTAGCC ATCTGCGCTT TGGTCCGACC
GAGGCGGAAA ACCGCGCCTT TGCGCTGGCC TTTTGGCCCG ACAGCCGGGG CATGACGCCC AAGGCGCTGG CGGGGCTGAT
CGCGGCAGAG GATCCGGTGG TGCAGGAGGC GGAGGGTTTC GCCCAGGTCT CGGTCGCGGC GCGCGGGCTC TATGCGCTGG
AGTTCCTGCT CTATGACGAG GGTCAGGCGG GCAACGACCC CTATCACTGT GCCCTGATCC GCGCCATCGT GCGCGACAGT
GCGGGGCTGG CACGGGCAAT GGCGGCGGAC TGGCATGACC GTTACGCGGC GCTGATGCGC GCGCCGGGGC CGGACAGCCC
CTATCGCAGT CGCGACGAGG CGATGCAGGA ACTGTTCAAG GCGCTGGGCA CCGGCTTGCA GATCACCGCC GATCTGCGTC
TGGGCCGGCC CTTGGGCAGT TTTGCCAGGC CGCGCCCGAA CCGGGCCGAG GCTTGGCGCG CAGGTCTGTC CCTCTTGCTG
GTCATCGAGG CATTGCACTC GCAGCGCCAG CTGGCGCTGC TGCTGGCCGA AGAGGATGCC GGGCTGAAAG CCCGGCTTAC
CGATGCCTTT GACCGGGCGC TGGGGGACGC TGCGGCGCTG GATGATCCGG CATTGGCCGG TGTCGCCACC CCTGCCGGGC
GGTTCCGGGT CGAGGCATTG CAACAGCGTG TCAACGAGAT CCGGCAGGTG GTGGCCCAGG AGCTGGGGCC GAAACTGGGG
GTTTCGGCGG GGTTCAACGC ATTGGACGGG GATTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7