Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0090
Type: gene
Description:
Source: GenBank
Position: DSS3:89159..90235 (+ strand)
Length: 1077
Dbxref: GeneID:3196424
load_id: SPO0090
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:89159..90235 (+ strand)
Length: 1077
load_id: SPO0090.t01
parent_id: SPO0090
Parts:
Type: CDS
Description: identified by similarity to GB:CAE37570.1; NCBI:hypothetical protein; IMG:hypothetical protein
Source: GenBank
Position: DSS3:89159..90235 (+ strand)
Length: 1077
Dbxref: GI:56695018
  GeneID:3196424
Note: identified by similarity to GB:CAE37570.1
  NCBI:hypothetical protein
  IMG:hypothetical protein
codon_start: 1
load_id: SPO0090.p01
parent_id: SPO0090.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0090
  YP_165364.1
transl_table: 11
translation: MTTRRGFLAGLAAAGLTPRAGWADAGAPAFLSAGRVADGAYNLYGLDRRGRPLFHLPIPD RGHAAAAHPQRAEAVAFARRPGRFALVLNCVSGAEIARLSAPEGRHFYGHGAFDAEGRVL FTTENDYEAGQGRIGLWDAGAGYRRIGEVASGGVGPHDIRLMPDGQTLVVANGGVETHPD TGRVKLNLPVMQPNLSYLSLAGEVLEVVRMPPEHRMNSIRHLDLRADGLVAFAMQWQGEG TELRPVLGLHRRGTAPVAVTGNEAEMRAMNGYGGSVIFYDQGRRVAVSSPRGGIVQLSDV AAGRIIGGVAITDVCGLGVTGGGLVASSGSGVFTRVGGKEASRSEIAWDNHLVAVNRA
Type: exon
Description:
Source: GenBank
Position: DSS3:89159..90235 (+ strand)
Length: 1077
parent_id: SPO0090.t01
> class=Sequence position=DSS3:89159..90235 (+ strand)
ATGACCACAC GACGCGGATT TCTGGCCGGG TTGGCGGCGG CAGGGCTGAC CCCGCGCGCC GGTTGGGCCG ATGCGGGCGC
CCCCGCTTTC CTGAGCGCCG GGCGCGTCGC CGATGGTGCC TACAACCTCT ATGGTCTGGA TAGGCGCGGC AGGCCGCTGT
TCCACCTGCC GATCCCGGAC CGGGGTCATG CCGCCGCCGC CCATCCCCAG CGGGCCGAGG CGGTGGCCTT TGCCCGTCGC
CCGGGCCGGT TCGCGCTGGT GCTGAACTGT GTGAGCGGGG CGGAAATCGC CCGGCTGAGC GCGCCCGAGG GGCGGCATTT
CTATGGTCAT GGCGCCTTTG ATGCCGAGGG CCGGGTTCTG TTCACCACCG AAAACGATTA CGAGGCCGGG CAGGGCCGGA
TCGGGCTGTG GGACGCCGGC GCGGGCTATC GGCGGATCGG CGAGGTTGCT TCGGGCGGGG TCGGCCCGCA TGACATCCGC
CTGATGCCGG ACGGGCAGAC ACTGGTGGTG GCCAATGGCG GGGTGGAAAC ACACCCCGAC ACTGGCCGGG TCAAGCTGAA
CCTGCCGGTG ATGCAGCCCA ACCTCAGTTA CCTTTCGCTG GCGGGAGAGG TGCTGGAGGT GGTGCGGATG CCCCCCGAGC
ATCGGATGAA TTCGATCCGT CATCTTGACC TGCGCGCCGA CGGGCTGGTG GCCTTTGCCA TGCAGTGGCA GGGCGAGGGC
ACCGAGCTGC GCCCGGTTCT GGGCCTGCAC CGGCGCGGCA CCGCGCCGGT TGCGGTGACG GGAAACGAGG CGGAAATGCG
CGCGATGAAC GGCTATGGCG GCAGTGTCAT TTTCTACGAC CAGGGCCGGC GCGTCGCGGT CTCCTCCCCC CGGGGCGGGA
TCGTGCAGCT GAGCGATGTC GCGGCGGGCC GGATCATCGG CGGTGTCGCG ATCACCGATG TCTGCGGGCT GGGCGTCACC
GGCGGCGGGT TGGTCGCCTC GTCAGGCAGC GGTGTCTTCA CCCGCGTGGG TGGTAAGGAA GCCAGCCGTT CCGAGATTGC
CTGGGACAAT CACCTGGTGG CGGTGAACCG CGCCTAG
>SPO0090 class=Sequence position=DSS3:89159..90235 (+ strand)
ATGACCACAC GACGCGGATT TCTGGCCGGG TTGGCGGCGG CAGGGCTGAC CCCGCGCGCC GGTTGGGCCG ATGCGGGCGC
CCCCGCTTTC CTGAGCGCCG GGCGCGTCGC CGATGGTGCC TACAACCTCT ATGGTCTGGA TAGGCGCGGC AGGCCGCTGT
TCCACCTGCC GATCCCGGAC CGGGGTCATG CCGCCGCCGC CCATCCCCAG CGGGCCGAGG CGGTGGCCTT TGCCCGTCGC
CCGGGCCGGT TCGCGCTGGT GCTGAACTGT GTGAGCGGGG CGGAAATCGC CCGGCTGAGC GCGCCCGAGG GGCGGCATTT
CTATGGTCAT GGCGCCTTTG ATGCCGAGGG CCGGGTTCTG TTCACCACCG AAAACGATTA CGAGGCCGGG CAGGGCCGGA
TCGGGCTGTG GGACGCCGGC GCGGGCTATC GGCGGATCGG CGAGGTTGCT TCGGGCGGGG TCGGCCCGCA TGACATCCGC
CTGATGCCGG ACGGGCAGAC ACTGGTGGTG GCCAATGGCG GGGTGGAAAC ACACCCCGAC ACTGGCCGGG TCAAGCTGAA
CCTGCCGGTG ATGCAGCCCA ACCTCAGTTA CCTTTCGCTG GCGGGAGAGG TGCTGGAGGT GGTGCGGATG CCCCCCGAGC
ATCGGATGAA TTCGATCCGT CATCTTGACC TGCGCGCCGA CGGGCTGGTG GCCTTTGCCA TGCAGTGGCA GGGCGAGGGC
ACCGAGCTGC GCCCGGTTCT GGGCCTGCAC CGGCGCGGCA CCGCGCCGGT TGCGGTGACG GGAAACGAGG CGGAAATGCG
CGCGATGAAC GGCTATGGCG GCAGTGTCAT TTTCTACGAC CAGGGCCGGC GCGTCGCGGT CTCCTCCCCC CGGGGCGGGA
TCGTGCAGCT GAGCGATGTC GCGGCGGGCC GGATCATCGG CGGTGTCGCG ATCACCGATG TCTGCGGGCT GGGCGTCACC
GGCGGCGGGT TGGTCGCCTC GTCAGGCAGC GGTGTCTTCA CCCGCGTGGG TGGTAAGGAA GCCAGCCGTT CCGAGATTGC
CTGGGACAAT CACCTGGTGG CGGTGAACCG CGCCTAG

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7