Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0091
Type: gene
Description:
Source: Genbank
Position: CP000031.2:90242..91147 (- strand)
Length: 906
gbkey: Gene
gene: SPO0091
gene_biotype: protein_coding
load_id: gene-SPO0091
locus_tag: SPO0091
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00581
Source: Genbank
Position: CP000031.2:90242..91147 (- strand)
Length: 906
Dbxref: NCBI_GP:AAV93422.1
IMG: SPO0091: rhodanese-like domain protein
Note: identified by match to protein family HMM PF00581
RefSeq: SPO_RS00460: rhodanese-related sulfurtransferase
gbkey: CDS
gene: SPO0091
load_id: cds-AAV93422.1
locus_tag: SPO0091
parent_id: gene-SPO0091
product: rhodanese-like domain protein
protein_id: AAV93422.1
transl_table: 11
translation: MYTIAALYHFTRFADPADLKPALLDLCLAQGVKGTLLLAKEGINGTIAGPRAGIDAVLAH IRALPGCSDLEWKEATSDHPPFGKMKVRLKQEIVTMGQPDVDPRARVGHYVEPEDWNDLI RSDDVVLIDTRNDYEVAIGTFEGAIDPMTESFRDFPAWWEANKERFHNKRVAMFCTGGIR CEKSTNYLLGQGVEDVYHLKGGILRYLEEVPAENSTWQGECFVFDNRVSVGHGLVEGPHE LCHGCRRPILPEDRNRPEYEHGVSCHLCIDETSEADKMRFRERQKQIALARARGEDHLAT H
>SPO0091 class=Sequence position=CP000031.2:90242..91147 (- strand)
ATGTACACGA TCGCCGCACT CTACCACTTC ACCCGGTTCG CCGACCCGGC CGACCTGAAA CCCGCCCTGC TGGACCTGTG
TCTGGCGCAA GGGGTCAAGG GCACGCTGCT GCTGGCCAAA GAGGGGATCA ACGGCACCAT CGCCGGACCG CGCGCCGGGA
TCGACGCGGT GCTGGCCCAT ATTCGCGCCT TGCCGGGTTG CTCTGACCTG GAGTGGAAAG AGGCGACCAG CGACCACCCG
CCCTTTGGCA AGATGAAGGT GCGGCTGAAG CAAGAGATCG TCACCATGGG CCAGCCGGAT GTCGACCCGC GCGCGCGCGT
CGGCCATTAT GTCGAACCTG AGGATTGGAA CGACCTGATC CGCTCGGACG ATGTGGTGCT GATCGACACC CGCAACGATT
ACGAGGTCGC CATCGGCACC TTCGAAGGCG CCATCGACCC GATGACCGAA AGTTTCCGGG ATTTCCCCGC CTGGTGGGAG
GCCAACAAGG AGCGGTTCCA CAACAAGCGC GTGGCGATGT TCTGCACCGG CGGCATCCGT TGCGAGAAGT CGACCAACTA
CCTGCTGGGT CAGGGGGTCG AGGATGTCTA TCACCTCAAG GGCGGTATCC TGCGCTATCT CGAAGAGGTA CCAGCCGAGA
ACAGCACCTG GCAGGGCGAA TGTTTCGTCT TCGACAACCG GGTCTCGGTC GGGCACGGGC TGGTCGAGGG GCCGCACGAG
CTGTGCCATG GCTGCCGCCG CCCGATCCTG CCCGAGGATC GCAATCGCCC GGAATACGAG CATGGGGTCA GCTGCCACCT
GTGCATCGAC GAGACCTCGG AGGCCGACAA AATGCGGTTC CGCGAACGGC AGAAACAGAT CGCCCTGGCC CGTGCCCGGG
GCGAGGACCA TCTGGCCACG CACTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7