Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0180
Type: CDS
Description: identified by similarity to SP:P24502
Source: Genbank
Position: CP000031.2:198271..198561 (- strand)
Length: 291
Dbxref: NCBI_GP:AAV93506.1
IMG: fliE: flagellar hook-basal body complex protein FliE
  putative
Note: identified by similarity to SP:P24502
RefSeq: SPO_RS00920: fliE: flagellar hook-basal body complex protein FliE
gbkey: CDS
gene: SPO0180
load_id: cds-AAV93506.1
locus_tag: SPO0180
parent_id: gene-SPO0180
product: flagellar hook-basal body complex protein FliE
  putative
protein_id: AAV93506.1
transl_table: 11
translation: MDIRSLSAAQAYASARPATQADPKDDSATQGLRGTFQDFAATLQHSEELAQSAMIGKADP HALVQALAQSELAVETAVTVRNKVVEAYQEILRMPV
>SPO0180 class=Sequence position=CP000031.2:198271..198561 (- strand)
ATGGATATCC GCAGCCTCTC CGCAGCCCAG GCCTATGCCT CGGCCCGCCC CGCCACCCAG GCGGACCCCA AAGACGACAG
CGCCACGCAG GGCCTGCGCG GCACCTTCCA GGATTTCGCC GCCACGCTGC AGCACAGCGA GGAGCTGGCC CAATCGGCGA
TGATCGGCAA GGCCGACCCG CATGCGCTGG TGCAGGCATT GGCGCAATCG GAACTGGCGG TCGAAACCGC TGTCACCGTC
CGCAACAAGG TGGTCGAGGC CTATCAGGAA ATCCTCCGGA TGCCGGTCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7