Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0092
Type: gene
Description:
Source: Genbank
Position: CP000031.2:91224..92447 (- strand)
Length: 1224
gbkey: Gene
gene: SPO0092
gene_biotype: protein_coding
load_id: gene-SPO0092
locus_tag: SPO0092
Parts:
Type: CDS
Description: identified by similarity to SP:P36928
Source: Genbank
Position: CP000031.2:91224..92447 (- strand)
Length: 1224
"ID: cds-AAV93424.1
Dbxref: NCBI_GP:AAV93424.1
IMG: SPO0092: heat shock protein
  Hsp70 family
Note: identified by similarity to SP:P36928
RefSeq: SPO_RS00465: Hsp70 family protein"
gbkey: CDS
gene: SPO0092
locus_tag: SPO0092
parent_id: gene-SPO0092
product: heat shock protein
  Hsp70 family
protein_id: AAV93424.1
transl_table: 11
translation: MARLGVDFGTSNTAAGLVQAGHPRVLPLEPGAQTLPTAVFIDFAARRYVYGTDAARAMMD GQEGRFLRGLKSILGTPLAREPRMFLNERLTLIEVIARFLAEIRTRAERLSGERFDRALS GRPVHFHSASAERDAQACTDLHDAYLMAGFSEVCFLPEPEAAALAVAGQGRMLIVDIGGG TSDFTLCDRRGTTTRMLASRGLRIGGTDFDRVLSLDHAMPLLGYEAQIGAELGEASHSAP RALFHDLASWEKIAFVYDPATLREVRRWVRLAEQPRLFERLAEVLESHLGHDVAYAVEAG KIAANGAAAGRIALDIVERGLGADLGNAAMQAALAGFADEIATCAMQTVRDAGVGPDSVD QVVFVGGSSLMGVIRAALARVLPGAEQQDSEVFTAVVHGLALASEDQ
>SPO0092 class=Sequence position=CP000031.2:91224..92447 (- strand)
ATGGCACGTC TTGGCGTGGA TTTCGGAACG TCCAACACCG CCGCCGGGCT GGTACAGGCG GGTCATCCCC GGGTTCTGCC
GCTGGAGCCG GGCGCACAGA CCCTGCCGAC CGCCGTCTTC ATCGACTTTG CCGCGCGCCG CTATGTCTAT GGCACCGACG
CCGCCCGGGC CATGATGGAC GGGCAAGAGG GCCGCTTTCT GCGGGGGCTG AAAAGCATTC TGGGCACCCC GCTGGCCCGC
GAACCCCGCA TGTTCCTGAA CGAGCGGCTG ACCCTGATCG AGGTCATCGC CCGCTTTCTG GCCGAGATTC GGACGCGCGC
CGAACGGCTG AGCGGAGAGC GTTTTGATCG CGCCCTGTCG GGCCGTCCGG TGCATTTCCA CTCTGCCTCA GCCGAGCGCG
ACGCGCAGGC CTGTACCGAT CTGCACGATG CCTATCTGAT GGCCGGGTTC AGCGAGGTCT GCTTTCTACC CGAACCCGAA
GCTGCCGCGT TGGCGGTGGC GGGTCAGGGG CGGATGCTGA TCGTCGACAT CGGCGGCGGC ACCTCGGATT TCACCCTGTG
CGACCGGCGG GGCACCACCA CCCGGATGCT GGCCAGCCGG GGTCTGCGCA TCGGCGGCAC CGATTTCGAC CGGGTGCTGA
GCCTGGATCA CGCCATGCCC CTGCTGGGAT ACGAGGCGCA GATCGGGGCC GAGCTGGGCG AGGCCAGCCA CAGCGCCCCC
CGGGCTCTGT TCCACGATCT GGCCAGCTGG GAAAAGATCG CCTTTGTCTA TGACCCTGCC ACCCTGCGCG AGGTACGGCG
CTGGGTGCGG CTTGCCGAAC AACCCCGCCT GTTCGAACGC CTGGCCGAGG TGTTGGAATC GCATCTGGGC CATGACGTGG
CCTATGCGGT CGAGGCAGGC AAGATCGCCG CAAATGGGGC CGCAGCGGGC CGCATCGCGC TGGATATCGT CGAACGCGGC
CTGGGCGCCG ATCTGGGAAA TGCGGCGATG CAGGCGGCGC TGGCCGGTTT CGCCGATGAG ATCGCCACTT GCGCCATGCA
GACGGTGCGC GATGCCGGGG TTGGCCCGGA CAGCGTCGAT CAGGTGGTGT TTGTCGGCGG ATCCAGCCTG ATGGGGGTGA
TCCGCGCCGC GCTGGCGCGC GTCCTGCCAG GCGCCGAACA ACAGGATTCC GAAGTATTCA CCGCGGTGGT TCACGGCCTC
GCACTGGCCA GTGAAGACCA ATAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7