Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0094
Type: CDS
Description: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF00785; match to protein family HMM PF00989; match to protein family HMM PF02518; match to protein family HMM TIGR00229
Source: Genbank
Position: CP000031.2:93264..95495 (+ strand)
Length: 2232
Dbxref: NCBI_GP:AAV93425.1
IMG: SPO0094: PAS/PAC sensor hybrid histidine kinase (EC 2.7.13.3)
Note: identified by match to protein family HMM PF00072; match to protein family HMM PF00512; match to protein family HMM PF00785; match to protein family HMM PF00989; match to protein family HMM PF02518; match to protein family HMM TIGR00229
RefSeq: SPO_RS00475: response regulator
gbkey: CDS
gene: SPO0094
load_id: cds-AAV93425.1
locus_tag: SPO0094
parent_id: gene-SPO0094
product: sensory box sensor histidine kinase/response regulator
protein_id: AAV93425.1
transl_table: 11
translation: MHVAGSPDVDHLSEYERRYSRRGLLIRYARGRVRNFAGRQIMTFAGSFILAMTEGLHTAM LAAFAALLGEVIDCLYLHRLPERLRQGQGYRRLLIGSTLTALVQALTISFCVWLAWTGAR SGLSPLFIGSFLAGAAINAGLVLPFHRPAAVARLAVYAGIGQYLFLIEAMEPGRLGDALL LNAAGAVMLAFMVGLFLNFVNWGFRQHRRTTLDLIEQGRDLLRHQKEAQLLSLVARNAND SVILADSEGRIVWTNESFTRTTGYSLDEAKGRYPGELLNGDKTDLEVSNAIADAVEAGRP FRTEILNVTKDGREIWMETNLVPVLDRNGKVEVTVAIERDVTAAKAQAEELAAARVAAEE GARAKAEFLATMSHEIRTPMNGVVGMAELLSETKLSIEQRQYVDTIRSSSTALLAIINDI LELSRLDARKMELHPVNFDPVSCVRDTMRLLKPQAQAKGLRLSLETGADVPPLVYGDDGR LRQVLINLLGNAIKFTERGGVTLRLRSEAQDPGYLLTLEVEDTGIGIAAEKIERVFERFS QADADTTRLYGGTGLGLTISRELVALMGGRITVDSTLGQGSCFTLCLPLGSPDDDAGQSD GQVLSPAELDRLRGLRVLVADDNRVNRLLMGKFLADLPIRLDFAHDGQQAVAMTQRQKPD IVFMDMSMPVMSGIEATRQIRAAEGRQPLIVALTANTFDSDREACLAAGMDDFLSKPVGR ADLFRCLLHHLPPTDAAPRTASG
>SPO0094 class=Sequence position=CP000031.2:93264..95495 (+ strand)
ATGCATGTTG CCGGGTCGCC CGATGTCGAC CACCTGTCTG AATACGAACG AAGATACAGC CGGCGCGGCC TGCTGATCCG
CTACGCACGC GGGCGGGTCA GGAATTTCGC CGGTCGTCAG ATCATGACAT TCGCCGGCAG TTTCATTCTT GCGATGACTG
AGGGTCTTCA TACCGCCATG TTGGCGGCCT TTGCCGCCTT GCTGGGCGAG GTGATCGACT GCCTCTACCT GCACCGGCTG
CCAGAGCGCT TGCGCCAGGG TCAGGGTTAC CGCCGCCTGC TGATTGGCAG TACCCTCACC GCCTTAGTTC AGGCGCTGAC
GATCAGCTTT TGCGTCTGGC TGGCCTGGAC AGGCGCGCGC AGCGGGCTGT CGCCGCTGTT CATCGGGTCG TTCCTGGCAG
GGGCTGCGAT CAATGCCGGG CTTGTGCTTC CGTTTCATCG CCCCGCCGCC GTGGCGCGTC TGGCGGTCTA TGCGGGGATC
GGCCAATACC TGTTCCTGAT CGAGGCGATG GAGCCGGGGC GGCTTGGCGA CGCGCTGTTG CTCAATGCCG CCGGTGCGGT
GATGTTGGCC TTCATGGTTG GCCTGTTCCT GAATTTCGTG AACTGGGGCT TTCGTCAGCA TCGCCGGACT ACGCTGGATT
TGATCGAACA GGGACGTGAC CTGCTGCGAC ATCAGAAGGA GGCGCAACTG CTGTCGCTGG TCGCCCGCAA CGCCAATGAC
AGCGTCATTC TGGCAGATTC CGAAGGCCGC ATCGTCTGGA CCAACGAGAG TTTTACCCGC ACCACCGGGT ATTCGCTGGA
CGAAGCCAAG GGGCGCTATC CCGGCGAGTT GCTGAATGGC GACAAGACAG ACCTTGAGGT TTCGAATGCG ATTGCCGATG
CCGTCGAGGC CGGCCGCCCG TTTCGAACCG AGATATTGAA TGTGACCAAG GACGGTCGCG AGATCTGGAT GGAAACCAAT
CTGGTGCCGG TGCTTGACCG GAACGGCAAG GTCGAAGTCA CCGTTGCGAT CGAGCGTGAC GTGACAGCCG CCAAGGCGCA
GGCCGAGGAA CTGGCCGCCG CGCGCGTCGC CGCCGAGGAG GGCGCGCGCG CCAAGGCCGA GTTTCTGGCC ACTATGAGCC
ACGAGATCAG GACGCCGATG AACGGCGTCG TGGGTATGGC CGAGCTGTTG TCGGAAACCA AGCTTTCGAT CGAGCAGCGG
CAATATGTCG ATACCATCCG AAGCTCTTCG ACCGCCTTGC TGGCGATCAT TAACGACATT CTGGAACTGT CGCGCCTGGA
TGCCCGGAAG ATGGAATTGC ATCCGGTGAA TTTCGATCCG GTGTCCTGTG TCAGGGACAC CATGCGCCTG CTGAAACCGC
AGGCGCAGGC CAAGGGGCTG AGGCTGTCTC TTGAAACAGG GGCCGATGTT CCCCCCCTCG TGTATGGTGA CGATGGGCGA
TTGCGCCAGG TTCTGATCAA TCTGCTTGGC AACGCGATCA AGTTCACCGA ACGCGGCGGT GTGACCCTGC GTTTGCGGTC
CGAGGCGCAG GACCCGGGAT ATCTGTTGAC GCTCGAGGTC GAGGATACCG GCATCGGCAT CGCCGCCGAA AAGATCGAGA
GGGTGTTCGA GCGGTTCTCG CAGGCGGATG CCGACACCAC GCGTCTTTAC GGCGGGACCG GCCTTGGGCT GACGATCTCG
CGCGAGCTGG TTGCGCTGAT GGGCGGTCGG ATCACCGTTG ACTCGACGCT TGGGCAGGGG TCGTGTTTTA CGCTGTGCCT
GCCGTTGGGG TCGCCCGATG ACGACGCCGG ACAATCAGAT GGGCAGGTGC TGTCACCGGC TGAGCTTGAC CGGTTGCGCG
GCCTGCGTGT GCTGGTTGCC GATGACAACC GTGTCAACCG TTTGCTCATG GGCAAGTTCC TGGCCGATCT GCCGATCCGC
CTGGACTTTG CCCATGATGG TCAGCAGGCG GTTGCCATGA CGCAGCGGCA AAAGCCTGAC ATCGTGTTCA TGGACATGTC
GATGCCGGTG ATGAGCGGCA TCGAGGCGAC CCGGCAGATC CGTGCCGCAG AGGGCAGGCA GCCCTTGATC GTGGCGCTGA
CCGCAAATAC GTTCGACAGC GACCGCGAAG CCTGTCTTGC CGCCGGGATG GACGATTTCC TCAGCAAACC GGTGGGCCGG
GCAGATCTGT TCCGGTGCCT GCTGCACCAT TTGCCACCCA CCGACGCGGC ACCAAGAACC GCATCCGGCT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7