Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0096
Type: CDS
Description: identified by match to protein family HMM PF00892; NCBI:hypothetical protein; IMG:EamA domain-containing membrane protein RarD
Source: GenBank
Position: DSS3:96926..97840 (- strand)
Length: 915
Dbxref: GI:56695024
  GeneID:3194541
Note: identified by match to protein family HMM PF00892
  NCBI:hypothetical protein
  IMG:EamA domain-containing membrane protein RarD
codon_start: 1
load_id: SPO0096.p01
parent_id: SPO0096.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0096
  YP_165370.1
transl_table: 11
translation: MNARSGDNVVLAILLSLLALVLFDMMGLIIKYLSPRYGAAELSAYRNFFGVFPSVIALWS SPGWHRAGRPWRIRQWRLGLMRGVYVTFAQFLFYYSLGKLAFATASTITYANAVFMTALA VPLLGERVGLMRWAAVLLGFAGVLLVMKPGSDSFTPDALAPLGAAFLYALTGVSARQMDS AVPSALINLYSVVAALVGALALALLSGGFTPLAQWSDLGWIAAMGGFGGTAVLCLVASYR MTEQSNLAPFSYFGIPIAFVAGWLVFDETPWADLFPGAFFIAGGGLMIVWRERIRSRAGR RISN
>SPO0096 class=Sequence position=DSS3:96926..97840 (- strand)
ATGAACGCGC GCAGCGGAGA TAACGTGGTT CTTGCCATCC TTTTGTCGCT GCTGGCGCTG GTCCTGTTCG ACATGATGGG
GCTGATCATC AAATACCTGT CGCCGCGCTA TGGTGCGGCA GAGCTGTCGG CCTATCGCAA CTTCTTCGGC GTCTTTCCCA
GCGTGATCGC ACTGTGGTCC TCGCCCGGGT GGCATCGGGC GGGGCGGCCC TGGCGCATCC GGCAGTGGCG GCTGGGGCTG
ATGCGCGGGG TCTATGTGAC CTTTGCCCAG TTCCTGTTCT ACTATTCGCT GGGCAAGCTG GCCTTTGCCA CCGCCTCGAC
CATCACCTAT GCCAATGCGG TGTTCATGAC CGCACTTGCG GTACCTCTGC TGGGCGAGCG GGTGGGGCTG ATGCGCTGGG
CGGCGGTGCT GCTCGGGTTT GCCGGGGTGC TTCTGGTGAT GAAGCCGGGC AGTGACAGTT TCACGCCGGA TGCGCTGGCG
CCGCTGGGGG CCGCATTCCT CTATGCGCTG ACCGGGGTGT CGGCGCGGCA GATGGACAGC GCGGTGCCAA GCGCGCTGAT
CAACCTCTAT TCGGTTGTGG CCGCGCTGGT CGGGGCATTG GCGCTGGCAT TGCTGAGCGG TGGGTTCACT CCGCTTGCTC
AATGGTCCGA CCTGGGATGG ATTGCGGCAA TGGGAGGGTT CGGAGGGACA GCGGTGCTGT GTCTGGTGGC CTCGTACCGG
ATGACCGAGC AGAGCAATCT GGCCCCCTTC AGCTATTTCG GCATTCCCAT CGCCTTTGTC GCGGGCTGGC TGGTGTTTGA
CGAAACGCCC TGGGCCGACC TGTTTCCTGG GGCGTTCTTC ATCGCGGGTG GTGGGCTCAT GATCGTTTGG CGCGAAAGGA
TCAGATCGCG GGCGGGGCGC CGAATTTCAA ACTGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7