Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0097
Type: gene
Description:
Source: GenBank
Position: DSS3:97843..99294 (- strand)
Length: 1452
Dbxref: GeneID:3196084
load_id: SPO0097
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:97843..99294 (- strand)
Length: 1452
load_id: SPO0097.t01
parent_id: SPO0097
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00171; NCBI:aldehyde dehydrogenase; IMG:
Source: GenBank
Position: DSS3:97843..99294 (- strand)
Length: 1452
Dbxref: GI:56695025
  GeneID:3196084
Note: identified by match to protein family HMM PF00171
  NCBI:aldehyde dehydrogenase
  IMG:
codon_start: 1
load_id: SPO0097.p01
parent_id: SPO0097.t01
product: aldehyde dehydrogenase family protein
protein_id: REF_tigr:SPO0097
  YP_165371.1
transl_table: 11
translation: MTLPLWFDPTLCLIGGRWQAPRGGDTLPLINPSDGTEICRIARGTAPDIDTAVTAAEAAL AGDWGRMTATERGRILSRLGQLVLERVEDLAVIEAWDVGKPLTQARADAVALARYCEFYG GAADKVMGETIPYLEGYTVYTLREPHGVTGHIVPWNYPMQIIGRSVGAALAMGNACVLKP AEEACLTALAFADLAKQAGLPAGALNVVPGLGAEAGAALSAHPGVHHISFTGSVATGALV QQAAGRNVVPVTLELGGKSPQLVFDDADLDTALPFLVNAGCQNAGQTCSASSRILAQRGV YEEVKARMAASYAELTVGPAMEDLRVGPLISARQKEIVTGFLDKGADLTIAAQGRIVDHA PETGAYVRPTLFADVPPDHALARDEIFGPVQVLIPFDTEEEAIAIANGTDYGLVASIWTR DGARQMRLAKRLRAGQVFVNNYGAGGGVELPFGGVGKSGHGREKGFEALYGFSQLKTVAA RHG
Type: exon
Description:
Source: GenBank
Position: DSS3:97843..99294 (- strand)
Length: 1452
parent_id: SPO0097.t01
> class=Sequence position=DSS3:97843..99294 (- strand)
ATGACCCTAC CCCTCTGGTT CGATCCCACC CTCTGCCTGA TCGGAGGCCG CTGGCAGGCC CCCCGGGGTG GCGATACCCT
GCCGCTGATC AACCCGTCCG ACGGGACCGA AATCTGCCGC ATCGCCCGTG GCACCGCACC CGATATTGAC ACGGCGGTGA
CAGCCGCCGA GGCCGCGCTG GCCGGTGACT GGGGCCGGAT GACCGCGACC GAGCGGGGCC GCATCCTGTC CCGTTTGGGC
CAGTTGGTGC TGGAGCGGGT CGAGGATCTG GCAGTGATCG AGGCCTGGGA TGTCGGCAAA CCGCTGACCC AGGCCCGCGC
CGATGCGGTG GCACTGGCGC GGTATTGCGA ATTCTACGGC GGTGCCGCCG ACAAGGTGAT GGGCGAGACC ATTCCCTATC
TCGAGGGCTA TACCGTCTAT ACCCTGCGCG AACCGCACGG GGTCACGGGA CATATCGTGC CCTGGAACTA TCCGATGCAG
ATCATCGGCC GTTCGGTCGG CGCGGCGCTG GCCATGGGCA ATGCCTGCGT TCTGAAACCG GCCGAAGAGG CCTGTCTGAC
CGCGCTGGCC TTTGCCGATC TGGCGAAACA GGCGGGGCTG CCCGCAGGTG CACTGAACGT GGTGCCGGGG CTGGGGGCCG
AGGCGGGCGC GGCACTGTCC GCTCATCCCG GCGTGCACCA TATCTCGTTC ACCGGATCGG TCGCCACTGG CGCGCTGGTG
CAGCAGGCGG CGGGGCGCAA TGTGGTGCCG GTCACGCTGG AACTGGGGGG CAAGTCGCCG CAGCTGGTGT TCGACGATGC
CGATCTGGAT ACCGCGCTGC CGTTCCTGGT GAATGCGGGG TGCCAGAATG CCGGTCAGAC CTGCTCGGCC TCTTCCCGCA
TTTTGGCCCA GCGCGGGGTC TATGAAGAGG TCAAGGCTCG CATGGCCGCA TCCTATGCCG AACTGACGGT TGGCCCCGCG
ATGGAGGATC TGCGGGTGGG GCCGTTGATC TCGGCCCGGC AAAAGGAGAT CGTGACCGGG TTTCTGGACA AGGGCGCCGA
CCTGACCATC GCGGCACAGG GCCGGATCGT GGACCACGCC CCCGAAACCG GGGCCTATGT GCGACCGACG CTGTTCGCCG
ATGTGCCCCC CGATCATGCG CTGGCCCGAG ACGAGATTTT CGGCCCTGTA CAGGTCCTGA TCCCCTTTGA CACCGAGGAA
GAGGCGATCG CCATCGCCAA TGGCACCGAT TACGGTCTGG TCGCCAGCAT CTGGACCCGC GACGGCGCGC GCCAGATGCG
TCTGGCCAAG CGGTTGCGGG CCGGACAGGT CTTCGTCAAC AATTACGGTG CCGGCGGCGG GGTCGAACTG CCCTTTGGCG
GGGTCGGCAA ATCCGGCCAC GGACGCGAGA AAGGCTTCGA AGCGCTCTAC GGTTTCTCGC AGCTCAAGAC CGTCGCCGCG
CGGCACGGCT GA
>SPO0097 class=Sequence position=DSS3:97843..99294 (- strand)
ATGACCCTAC CCCTCTGGTT CGATCCCACC CTCTGCCTGA TCGGAGGCCG CTGGCAGGCC CCCCGGGGTG GCGATACCCT
GCCGCTGATC AACCCGTCCG ACGGGACCGA AATCTGCCGC ATCGCCCGTG GCACCGCACC CGATATTGAC ACGGCGGTGA
CAGCCGCCGA GGCCGCGCTG GCCGGTGACT GGGGCCGGAT GACCGCGACC GAGCGGGGCC GCATCCTGTC CCGTTTGGGC
CAGTTGGTGC TGGAGCGGGT CGAGGATCTG GCAGTGATCG AGGCCTGGGA TGTCGGCAAA CCGCTGACCC AGGCCCGCGC
CGATGCGGTG GCACTGGCGC GGTATTGCGA ATTCTACGGC GGTGCCGCCG ACAAGGTGAT GGGCGAGACC ATTCCCTATC
TCGAGGGCTA TACCGTCTAT ACCCTGCGCG AACCGCACGG GGTCACGGGA CATATCGTGC CCTGGAACTA TCCGATGCAG
ATCATCGGCC GTTCGGTCGG CGCGGCGCTG GCCATGGGCA ATGCCTGCGT TCTGAAACCG GCCGAAGAGG CCTGTCTGAC
CGCGCTGGCC TTTGCCGATC TGGCGAAACA GGCGGGGCTG CCCGCAGGTG CACTGAACGT GGTGCCGGGG CTGGGGGCCG
AGGCGGGCGC GGCACTGTCC GCTCATCCCG GCGTGCACCA TATCTCGTTC ACCGGATCGG TCGCCACTGG CGCGCTGGTG
CAGCAGGCGG CGGGGCGCAA TGTGGTGCCG GTCACGCTGG AACTGGGGGG CAAGTCGCCG CAGCTGGTGT TCGACGATGC
CGATCTGGAT ACCGCGCTGC CGTTCCTGGT GAATGCGGGG TGCCAGAATG CCGGTCAGAC CTGCTCGGCC TCTTCCCGCA
TTTTGGCCCA GCGCGGGGTC TATGAAGAGG TCAAGGCTCG CATGGCCGCA TCCTATGCCG AACTGACGGT TGGCCCCGCG
ATGGAGGATC TGCGGGTGGG GCCGTTGATC TCGGCCCGGC AAAAGGAGAT CGTGACCGGG TTTCTGGACA AGGGCGCCGA
CCTGACCATC GCGGCACAGG GCCGGATCGT GGACCACGCC CCCGAAACCG GGGCCTATGT GCGACCGACG CTGTTCGCCG
ATGTGCCCCC CGATCATGCG CTGGCCCGAG ACGAGATTTT CGGCCCTGTA CAGGTCCTGA TCCCCTTTGA CACCGAGGAA
GAGGCGATCG CCATCGCCAA TGGCACCGAT TACGGTCTGG TCGCCAGCAT CTGGACCCGC GACGGCGCGC GCCAGATGCG
TCTGGCCAAG CGGTTGCGGG CCGGACAGGT CTTCGTCAAC AATTACGGTG CCGGCGGCGG GGTCGAACTG CCCTTTGGCG
GGGTCGGCAA ATCCGGCCAC GGACGCGAGA AAGGCTTCGA AGCGCTCTAC GGTTTCTCGC AGCTCAAGAC CGTCGCCGCG
CGGCACGGCT GA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7