Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0098
Type: gene
Description:
Source: Genbank
Position: CP000031.2:99759..101357 (- strand)
Length: 1599
gbkey: Gene
gene: SPO0098
gene_biotype: protein_coding
load_id: gene-SPO0098
locus_tag: SPO0098
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00005
Source: Genbank
Position: CP000031.2:99759..101357 (- strand)
Length: 1599
"ID: cds-AAV93429.1
Dbxref: NCBI_GP:AAV93429.1
IMG: SPO0098: peptide/opine/nickel uptake family ABC transporter
  ATP-binding protein
Note: identified by match to protein family HMM PF00005
RefSeq: SPO_RS00495: ABC transporter ATP-binding protein"
gbkey: CDS
gene: SPO0098
locus_tag: SPO0098
parent_id: gene-SPO0098
product: peptide/opine/nickel uptake family ABC transporter
  ATP-binding protein
protein_id: AAV93429.1
transl_table: 11
translation: MSLLQITDLSLSIHAYDILKRVSLTIDAGEIVAVTGESGSGKSMTALAVMQLLPGGARAS GSIRLDGQEILTLPEAEMCALRGAAVGMVFQEPMTALNPVKTIGDQVMETILIHKAMTPI RAEERAREVLTRVGLPPDRFPLSRYPHELSGGQRQRVVIAMAIALRPKLLIADEPTTALD VTTQAQILDLLKGLVQEYGMGMLMITHDLAVVADMADHITVMRHGEVVEAAPTQRLLTGM SHPYTKMLFAASDHRVTLPAPPPPAPLLEVSEVVRDYALPRTRLFAHPGHHRAVDHVSFA LNRGERLGLVGESGCGKSTLTRAILGLEPVQGGEIRLAGQPVYDGKRANPEIRRRMQVVF QDPYGSFNPRHRVDRLVTEPFHLLDAPPTGSDRSDRIAEMLTAVGLSPDDAGKYIHEFSG GQRQRIAIARALIIRPQLILFDEAVSALDVSVRAQILDLLAQLCSEYDLTYLFISHDLSV VRTITDRVLVMQSGRIVEQGETAQVFSDPAHPYTRALIAAAPRLPETGARRA
>SPO0098 class=Sequence position=CP000031.2:99759..101357 (- strand)
ATGAGCCTGT TGCAGATCAC CGACCTGTCG CTGTCGATCC ATGCCTATGA CATCCTCAAG CGCGTCTCAC TGACCATCGA
CGCGGGCGAG ATCGTGGCCG TCACCGGCGA GAGCGGCTCG GGCAAGTCGA TGACGGCGCT GGCCGTGATG CAGCTGTTGC
CCGGCGGAGC GCGAGCCAGC GGCTCGATCC GGCTGGACGG ACAAGAGATT CTGACCCTGC CCGAGGCAGA AATGTGCGCC
CTGCGCGGCG CGGCGGTCGG GATGGTGTTT CAGGAACCGA TGACCGCACT GAACCCGGTC AAGACCATCG GCGATCAGGT
GATGGAAACG ATCCTGATCC ACAAAGCGAT GACGCCCATC AGGGCGGAAG AGCGCGCGCG CGAAGTGCTG ACCCGTGTCG
GCCTGCCGCC TGACCGGTTC CCGCTTTCGC GCTATCCGCA TGAACTCAGC GGCGGCCAGC GCCAGCGCGT GGTCATCGCC
ATGGCCATCG CACTGCGCCC GAAACTGCTG ATCGCGGACG AGCCGACAAC CGCGCTCGAC GTCACCACGC AGGCGCAGAT
CCTCGACCTG CTCAAGGGGC TGGTGCAGGA ATACGGCATG GGCATGCTGA TGATCACCCA TGACCTGGCC GTTGTTGCCG
ACATGGCCGA CCATATCACC GTCATGCGCC ATGGCGAGGT GGTCGAGGCC GCCCCGACCC AGCGCCTGCT GACCGGTATG
AGTCATCCCT ATACGAAGAT GCTGTTCGCC GCCTCGGATC ACCGCGTGAC CCTGCCCGCG CCACCGCCAC CGGCACCGCT
GCTGGAGGTG TCGGAGGTGG TGCGCGACTA TGCCCTGCCG CGCACCCGGC TGTTTGCGCA CCCGGGGCAT CACCGCGCCG
TGGATCATGT CAGCTTTGCC CTGAACCGGG GCGAGCGGCT GGGGCTGGTC GGCGAATCCG GCTGTGGCAA ATCCACCCTG
ACACGCGCCA TCCTGGGGCT GGAGCCGGTA CAGGGCGGCG AAATCCGTCT GGCGGGGCAA CCGGTCTATG ACGGCAAACG
CGCCAATCCC GAAATCCGCC GCCGCATGCA GGTGGTGTTT CAGGATCCTT ACGGCAGCTT CAACCCGCGC CACCGTGTCG
ACCGGCTGGT GACCGAACCG TTTCATCTGC TCGATGCGCC GCCAACCGGG TCGGACCGCA GCGACCGCAT TGCCGAGATG
CTGACCGCCG TCGGCCTGTC GCCCGACGAT GCGGGAAAGT ATATCCACGA GTTTTCCGGC GGTCAGCGCC AGCGCATCGC
CATTGCCCGT GCGCTGATCA TCCGGCCTCA GCTGATCCTG TTCGACGAGG CGGTCTCGGC GCTTGATGTC TCGGTCCGGG
CGCAGATCCT TGACCTGCTG GCGCAGCTCT GCTCCGAATA TGACCTGACC TATCTGTTCA TCAGCCATGA TCTGAGCGTG
GTGCGCACGA TCACCGACCG GGTGCTGGTG ATGCAATCGG GCCGCATTGT CGAACAGGGC GAGACCGCAC AGGTCTTCTC
GGACCCCGCG CATCCCTATA CCCGGGCCCT GATCGCCGCC GCGCCGCGTC TGCCCGAAAC CGGGGCGCGG CGGGCATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7