Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0099
Type: gene
Description:
Source: Genbank
Position: CP000031.2:101354..102169 (- strand)
Length: 816
gbkey: Gene
gene: SPO0099
gene_biotype: protein_coding
load_id: gene-SPO0099
locus_tag: SPO0099
Parts:
Type: CDS
Description: identified by match to protein family HMM PF00528
Source: Genbank
Position: CP000031.2:101354..102169 (- strand)
Length: 816
"ID: cds-AAV93430.1
Dbxref: NCBI_GP:AAV93430.1
IMG: SPO0099: peptide/opine/nickel uptake family ABC transporter
  permease protein
Note: identified by match to protein family HMM PF00528
RefSeq: SPO_RS00500: ABC transporter permease"
gbkey: CDS
gene: SPO0099
locus_tag: SPO0099
parent_id: gene-SPO0099
product: peptide/opine/nickel uptake family ABC transporter
  permease protein
protein_id: AAV93430.1
transl_table: 11
translation: MSRNLILGAGLSSLVVLAALISFIWTPYDHAALNIPAKLQTPNARHWFGTDHFGRDMFSM IMVGARTSIAVALLAVGIGMSLGVPLGLAAAARKGSWLDELIMRGNDLVFAFPSLVIAIL ITAVFGAGAVNAIIAIGIFNIPVFARITRGAALSLWEREFILAARVAGKGAARISAEHIL PNVANLLIVQGTIQFSLGILAEAGLSYVGLGAQPPTPSWGRMLADAQTMVSFAPHLALIP GLAIILTVLGLNLMGDGLRDWLDPRLRVART
>SPO0099 class=Sequence position=CP000031.2:101354..102169 (- strand)
ATGAGCCGCA ACCTGATCCT GGGCGCGGGC CTGTCCTCGC TGGTGGTGCT GGCCGCGCTC ATCTCTTTCA TCTGGACTCC
CTACGACCAT GCCGCGCTGA ACATCCCGGC CAAGCTGCAA ACCCCGAATG CGCGGCACTG GTTCGGCACC GACCATTTCG
GGCGCGACAT GTTTTCCATG ATCATGGTCG GCGCGCGCAC CTCGATCGCG GTGGCCCTGC TGGCGGTGGG TATCGGCATG
AGCCTGGGCG TGCCGCTGGG CTTGGCGGCC GCGGCGCGCA AGGGATCGTG GCTGGACGAG TTGATCATGC GCGGCAACGA
TCTGGTCTTT GCGTTCCCCT CGCTGGTGAT CGCCATCCTG ATCACCGCCG TCTTTGGCGC TGGCGCCGTC AACGCCATCA
TCGCCATCGG CATCTTCAAC ATCCCGGTCT TTGCCCGCAT CACCCGTGGC GCCGCGCTCA GCCTGTGGGA GCGCGAATTC
ATCCTGGCGG CGCGCGTCGC GGGCAAGGGG GCAGCGCGCA TCTCGGCCGA ACATATCCTG CCAAACGTGG CGAACCTGCT
AATCGTGCAG GGCACCATCC AGTTCTCGCT GGGCATCCTG GCCGAGGCGG GGCTGAGTTA TGTCGGCCTT GGCGCGCAGC
CGCCGACGCC CAGCTGGGGC CGGATGCTGG CGGACGCGCA GACCATGGTC AGTTTCGCCC CCCATCTGGC GCTGATCCCC
GGACTGGCGA TCATCCTGAC GGTGCTGGGT CTGAACCTGA TGGGCGACGG GCTGCGCGAC TGGCTCGATC CCCGGCTCAG
GGTGGCGCGC ACATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7