Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0100
Type: CDS
Description: identified by match to protein family HMM PF00528
Source: Genbank
Position: CP000031.2:102166..103113 (- strand)
Length: 948
"ID: cds-AAV93431.1
Dbxref: NCBI_GP:AAV93431.1
IMG: SPO0100: peptide/opine/nickel uptake family ABC transporter
  permease protein
Note: identified by match to protein family HMM PF00528
RefSeq: SPO_RS00505: ABC transporter permease"
gbkey: CDS
gene: SPO0100
locus_tag: SPO0100
parent_id: gene-SPO0100
product: peptide/opine/nickel uptake family ABC transporter
  permease protein
protein_id: AAV93431.1
transl_table: 11
translation: MLRYSLKRALSLAISLAVASLVIFAVIEIAPGDPASFMLGVNAQPDTLAALRTELGLDQS KAERYVSWVTGMLRGDFGTSYTYRTPVSQMIADRLWVSLPLALYALALSTAIALPAGIYA AARRGKPGDLAVMGATQLGVAVPNFWFAMMLVLIFAINLRWFNAGGFAGWDKGLTAGLHS LTLPAIALALPQAAILARVMRSALLDILGEDFMRTARAKGLTRRQALWRHGLRNALIPVL TIIGLQFSFLLAGSIIIEQVFYLPGLGRLVFQAISARDLIVVESVVMLLVFAVIVVNFLV DLAYALVDPRLRTRT
>SPO0100 class=Sequence position=CP000031.2:102166..103113 (- strand)
ATGCTCCGTT ACAGCCTGAA ACGCGCGCTC TCGCTTGCGA TCAGCCTGGC CGTCGCCAGC CTGGTCATCT TTGCGGTGAT
CGAGATCGCT CCGGGGGATC CGGCCTCGTT CATGCTGGGG GTCAATGCGC AGCCCGATAC GCTGGCCGCG CTGCGCACCG
AGCTGGGTCT GGATCAGTCA AAGGCCGAAC GTTATGTCAG CTGGGTCACC GGCATGCTGC GTGGCGATTT TGGCACCTCT
TACACCTATC GCACCCCGGT TTCGCAGATG ATCGCGGACC GGCTCTGGGT CTCGCTGCCG CTCGCGCTCT ACGCGCTGGC
ACTGTCCACC GCCATCGCCC TGCCCGCCGG CATTTATGCC GCAGCCCGCC GGGGCAAACC CGGCGATCTG GCCGTGATGG
GCGCGACCCA GCTGGGCGTC GCGGTGCCCA ACTTCTGGTT CGCCATGATG CTGGTTCTGA TCTTTGCCAT CAACCTGCGC
TGGTTCAATG CCGGCGGTTT TGCCGGCTGG GACAAGGGGC TGACCGCCGG TCTGCATTCG CTGACCCTGC CCGCCATCGC
TCTGGCCCTG CCGCAGGCGG CGATCCTGGC GCGGGTGATG CGTTCGGCCC TGCTCGACAT CCTGGGTGAG GATTTCATGC
GCACCGCGCG GGCCAAGGGG CTCACCCGCC GTCAGGCGCT GTGGCGGCAT GGGTTGCGCA ATGCACTGAT CCCGGTGCTG
ACCATCATCG GCCTGCAATT CTCGTTCCTG CTGGCGGGAT CGATCATCAT CGAGCAGGTG TTCTATCTGC CCGGCCTCGG
GCGGCTGGTA TTCCAGGCGA TCTCGGCACG CGACCTGATC GTGGTGGAAT CGGTCGTCAT GCTGCTGGTC TTTGCGGTGA
TCGTGGTCAA TTTCCTGGTC GATCTGGCCT ATGCTCTCGT CGATCCGCGC CTGAGGACGC GGACATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7