Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0105
Type: CDS
Description: identified by match to protein family HMM PF01360
Source: Genbank
Position: CP000031.2:108119..109378 (- strand)
Length: 1260
Dbxref: NCBI_GP:AAV93436.1
IMG: SPO0105: hypothetical protein
Note: identified by match to protein family HMM PF01360
RefSeq: SPO_RS00530: flavin-dependent oxidoreductase
gbkey: CDS
gene: SPO0105
load_id: cds-AAV93436.1
locus_tag: SPO0105
parent_id: gene-SPO0105
product: monooxygenase family protein
protein_id: AAV93436.1
transl_table: 11
translation: MTVLIAGAGIAGLSLGLTLHQIGVPFRIYEATAVLRPMGVGINLQPNAVRELLDLGLEAE LDRIGVRTRQLGFYSKLGKTIWEEPRGIWAGYAWPQYSVHRGALQMMLYEALIARAGADC VVTGARAAGFETGPESATLILSDGRRVEGRLLIAADGIHSALRAQMYPNEGEPIWNGRVL WRATTRAPAYFGGGAMAMIGHDDLRLVSYPISEPDGDGMVEMNWIAEKRFPLDAAWKKED WNRAADIGDFLPDFADWRFDWIDVPALIQGAEVVYEYPMVDRDPLPRWTGGSVTLMGDAA HPTYPVGSNGASQAILDARIIGARLLEHGITPRALAAYEAEVRPVTTAVGQANRAGGGPD GVLQRVEDLCGGDFDDIDTVIPHAELAAHAARYKSIAGFSIEELNARPRTIAEGARIPA
>SPO0105 class=Sequence position=CP000031.2:108119..109378 (- strand)
ATGACCGTTC TGATTGCCGG TGCAGGTATC GCGGGGCTCA GCCTGGGGCT GACGCTGCAC CAGATCGGGG TGCCGTTCCG
CATCTACGAG GCAACGGCGG TGCTGCGCCC GATGGGGGTG GGGATCAACC TGCAACCCAA TGCGGTGCGC GAGTTGCTGG
ATCTAGGGCT GGAAGCGGAA CTGGACCGGA TCGGGGTGCG GACGCGCCAA CTGGGGTTCT ACTCAAAACT CGGCAAGACC
ATCTGGGAAG AGCCGCGCGG CATCTGGGCC GGTTATGCCT GGCCGCAGTA CTCGGTGCAT CGCGGCGCCT TGCAGATGAT
GCTGTACGAG GCGCTGATCG CCCGCGCCGG GGCAGATTGC GTGGTGACCG GTGCACGCGC TGCCGGGTTC GAAACCGGGC
CAGAGAGTGC GACCTTGATC CTGAGCGATG GGCGCCGGGT CGAGGGGCGG TTGCTGATCG CCGCCGACGG TATCCATTCG
GCACTCAGGG CTCAGATGTA CCCGAACGAG GGCGAACCGA TCTGGAACGG GCGCGTGCTG TGGCGCGCCA CCACCCGGGC
ACCCGCCTAT TTCGGTGGCG GCGCCATGGC GATGATCGGC CATGACGACC TGCGGCTGGT GTCTTATCCG ATTTCGGAGC
CGGACGGCGA CGGCATGGTC GAAATGAACT GGATCGCCGA GAAACGCTTT CCCCTCGATG CCGCGTGGAA GAAAGAGGAT
TGGAACCGCG CCGCCGATAT CGGTGATTTC CTGCCCGATT TCGCCGACTG GCGGTTCGAC TGGATCGACG TTCCCGCGCT
GATCCAAGGG GCCGAGGTGG TCTATGAATA CCCGATGGTC GACCGCGACC CCCTGCCCCG CTGGACGGGC GGGTCGGTGA
CCCTGATGGG CGATGCGGCG CATCCCACCT ATCCGGTGGG ATCGAACGGG GCCAGTCAGG CGATTCTGGA TGCGCGCATC
ATTGGTGCCC GGCTGCTGGA GCATGGGATA ACACCCAGGG CGCTGGCGGC CTATGAGGCC GAGGTCCGCC CGGTGACCAC
CGCCGTTGGC CAGGCCAATC GTGCGGGCGG CGGGCCGGAC GGGGTGCTGC AACGGGTCGA GGATCTGTGC GGCGGCGATT
TCGACGATAT TGACACCGTG ATCCCCCACG CCGAACTGGC CGCGCATGCG GCCAGGTACA AATCCATCGC CGGGTTCTCG
ATAGAAGAGC TGAATGCGCG CCCCCGTACC ATCGCCGAAG GCGCGCGGAT ACCAGCCTAG 

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7