Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0106
Type: gene
Description:
Source: Genbank
Position: CP000031.2:109440..110210 (- strand)
Length: 771
gbkey: Gene
gene: SPO0106
gene_biotype: protein_coding
load_id: gene-SPO0106
locus_tag: SPO0106
Parts:
Type: CDS
Description: identified by similarity to SP:Q9A321; match to protein family HMM PF03883
Source: Genbank
Position: CP000031.2:109440..110210 (- strand)
Length: 771
Dbxref: NCBI_GP:AAV93437.1
IMG: SPO0106: hypothetical protein
Note: identified by similarity to SP:Q9A321; match to protein family HMM PF03883
RefSeq: SPO_RS00535: yaaA: peroxide stress protein YaaA
gbkey: CDS
gene: SPO0106
load_id: cds-AAV93437.1
locus_tag: SPO0106
parent_id: gene-SPO0106
product: hypothetical protein
protein_id: AAV93437.1
transl_table: 11
translation: MLVVISPAKRLDWAERDVATTEPAFQDDAVRLAKTARNLTLGDLKKLMGLSDDLARLNRD RFREFADAPGADVTRPAALAFAGDTYQGLEAASLDSEEMDWAQQHLRILSGLYGVLRPLD AIQAYRLEMGSRLKTRRGTSLYDYWGDQLSRTLNAQADEIGTDVLVNCASQEYFGAVDPK ALKLRVITPVFMEDKGGAPKIVSFFAKKARGAMARYIVQRRLTDPQALSEFDSGGYQYNA DLSAPDKPVFLRPYQG
>SPO0106 class=Sequence position=CP000031.2:109440..110210 (- strand)
ATGCTGGTGG TGATCTCTCC GGCCAAGCGG CTGGATTGGG CAGAGCGCGA CGTCGCGACG ACCGAGCCCG CCTTTCAGGA
CGATGCGGTG CGGCTGGCCA AGACCGCGCG CAACCTGACG CTCGGCGATC TCAAGAAACT GATGGGGCTG AGCGACGATC
TGGCCCGGCT CAACCGCGAC CGGTTCCGCG AATTCGCCGA TGCGCCGGGC GCGGATGTGA CCCGCCCTGC CGCGCTGGCC
TTTGCCGGTG ACACCTATCA GGGGCTCGAG GCGGCCTCGC TCGACTCCGA GGAAATGGAC TGGGCGCAGC AGCACCTGCG
CATCCTGTCG GGGCTTTACG GCGTGTTGCG TCCGCTGGAT GCGATCCAGG CCTATCGTCT GGAAATGGGC AGCCGGTTGA
AGACCCGGCG AGGGACCTCT CTCTATGACT ATTGGGGTGA CCAGCTGTCC CGGACGCTGA ACGCTCAGGC CGATGAAATC
GGCACGGATG TGCTGGTCAA CTGCGCTAGC CAGGAATACT TTGGCGCCGT CGACCCCAAG GCGCTGAAAC TGCGGGTGAT
CACGCCCGTG TTCATGGAGG ACAAGGGCGG CGCGCCCAAG ATCGTCAGCT TTTTCGCCAA GAAGGCGCGC GGGGCGATGG
CCCGTTACAT CGTGCAACGC CGTCTGACCG ATCCACAGGC GCTGAGCGAG TTCGACAGCG GCGGATACCA GTACAACGCT
GACCTGTCCG CACCCGACAA GCCAGTGTTC CTGCGCCCCT ATCAAGGCTG A

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7