Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0108
Type: CDS
Description: identified by similarity to GB:AAR33383.1
Source: Genbank
Position: CP000031.2:112680..112952 (- strand)
Length: 273
"ID: cds-AAV97110.1
Dbxref: NCBI_GP:AAV97110.1
IMG:
Note: identified by similarity to GB:AAR33383.1
RefSeq: SPO_RS22360: transposase"
gbkey: CDS
gene: SPO0108
locus_tag: SPO0108
parent_id: gene-SPO0108
product: transposase
  truncation
protein_id: AAV97110.1
transl_table: 11
translation: MQISKRPRWRWQRCGATRPCRRHLDNIVIERLWRSLKQEAIYLEEITDSFQVRRISKGWM AFYNTRPHSALDRQTPDDAYRPGLNERNAA
>SPO0108 class=Sequence position=CP000031.2:112680..112952 (- strand)
TTGCAGATCA GTAAAAGGCC AAGGTGGCGG TGGCAGCGCT GCGGGGCGAC AAGACCGTGC AGGAGACACC TCGACAACAT
CGTCATCGAA CGACTCTGGC GCAGCCTGAA GCAGGAGGCG ATCTATCTCG AAGAAATCAC TGACAGCTTC CAGGTCCGAC
GCATCAGCAA GGGCTGGATG GCTTTCTACA ACACCCGCCC CCATTCCGCG CTTGATCGGC AGACACCGGA CGACGCATAT
CGGCCAGGCT TGAACGAGCG AAACGCAGCA TGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7