Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0109
Type: gene
Description:
Source: Genbank
Position: CP000031.2:113139..114266 (- strand)
Length: 1128
gbkey: Gene
gene: SPO0109
gene_biotype: protein_coding
load_id: gene-SPO0109
locus_tag: SPO0109
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01061
Source: Genbank
Position: CP000031.2:113139..114266 (- strand)
Length: 1128
Dbxref: NCBI_GP:AAV93439.1
IMG: SPO0109: ABC-2 type transport system permease protein
Note: identified by match to protein family HMM PF01061
RefSeq: SPO_RS00545: ABC transporter permease
gbkey: CDS
gene: SPO0109
load_id: cds-AAV93439.1
locus_tag: SPO0109
parent_id: gene-SPO0109
product: hypothetical protein
protein_id: AAV93439.1
transl_table: 11
translation: MWQWLTNVFRLGLKELNSLRADPVLILLIVYVFSFAVYSVATGAKLEVSNASVAYVDQDR SALTGRILGAILPPEFNPPQEISAGEIESVMNSGKFVFVLSFPPSFEADVLSGHKPQIQL NVDATAMAQAGNGSVFLQQIILAEVAKFVSGDDITTTRLIDLVVRTKFNPNLNSIWFSSV MQIINNITILSVLLTGAALIREREHGTIEHLLVMPVTPSEIMVAKIWANGLVIVVAAILS LWIVVQTVLAVPIAGSIPLFVCGAVLYLASVTGLGILLATFTTSMPQFGLLSLPVLVIMN LLSGSTTPMESMPVWLQNVMQLSPSTHFVSFSQAILYRDAGLDIVWPDMVVMVALSAVFF FIALKRFRVTMATVR
>SPO0109 class=Sequence position=CP000031.2:113139..114266 (- strand)
ATGTGGCAAT GGCTTACCAA TGTCTTCCGG CTTGGCCTCA AGGAACTCAA CAGCCTGCGT GCCGATCCCG TGCTTATTCT
GCTGATCGTC TATGTGTTCA GCTTCGCCGT CTATTCGGTT GCGACCGGTG CCAAGCTTGA GGTCTCGAAC GCCTCTGTCG
CCTATGTGGA CCAGGACCGT TCGGCACTGA CGGGGCGCAT TTTGGGCGCG ATCCTTCCAC CCGAATTCAA TCCGCCACAG
GAAATCTCGG CCGGTGAGAT TGAAAGCGTG ATGAACAGCG GCAAGTTCGT GTTTGTCCTG TCATTTCCAC CCAGTTTCGA
GGCGGATGTG CTGAGCGGCC ACAAACCTCA GATACAGCTC AACGTGGATG CCACCGCAAT GGCACAGGCC GGTAACGGTT
CGGTGTTCCT TCAGCAGATC ATCCTCGCTG AAGTCGCCAA GTTCGTTTCC GGCGACGACA TCACAACCAC TCGGCTGATC
GACCTGGTCG TCAGGACAAA GTTCAATCCG AACCTGAATT CCATCTGGTT TTCATCCGTG ATGCAGATCA TCAACAACAT
CACCATCCTG TCTGTACTTT TGACCGGCGC CGCGCTGATC CGCGAGCGCG AACATGGCAC GATCGAACAT TTGCTGGTGA
TGCCGGTCAC CCCGTCCGAG ATCATGGTTG CCAAGATATG GGCCAACGGC CTTGTGATCG TTGTCGCCGC CATCCTGTCG
CTCTGGATCG TCGTGCAGAC CGTGTTGGCG GTTCCGATCG CGGGTTCGAT CCCGCTCTTC GTATGCGGGG CGGTGCTTTA
CCTTGCCTCG GTCACGGGGC TCGGTATCCT GCTGGCCACC TTCACCACGT CGATGCCGCA ATTCGGTCTG TTGTCGCTCC
CGGTTCTCGT GATCATGAAT TTGCTGTCCG GCAGTACGAC GCCGATGGAA AGCATGCCGG TCTGGCTTCA GAACGTCATG
CAGTTGTCAC CGTCGACACA TTTCGTGTCG TTTTCTCAAG CCATTCTCTA TCGCGATGCC GGACTGGATA TCGTCTGGCC
CGACATGGTG GTCATGGTCG CGCTCAGCGC GGTCTTTTTC TTCATCGCGC TCAAGCGATT CAGGGTGACC ATGGCCACAG
TTCGCTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7