Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0109
Type: gene
Description:
Source: GenBank
Position: DSS3:113139..114266 (- strand)
Length: 1128
Dbxref: GeneID:3193800
load_id: SPO0109
Parts:
Type: mRNA
Description:
Source: GenBank
Position: DSS3:113139..114266 (- strand)
Length: 1128
load_id: SPO0109.t01
parent_id: SPO0109
Parts:
Type: CDS
Description: identified by match to protein family HMM PF01061; NCBI:membrane protein; IMG:ABC-2 type transport system permease protein
Source: GenBank
Position: DSS3:113139..114266 (- strand)
Length: 1128
Dbxref: GI:56695036
  GeneID:3193800
Note: identified by match to protein family HMM PF01061
  NCBI:membrane protein
  IMG:ABC-2 type transport system permease protein
codon_start: 1
load_id: SPO0109.p01
parent_id: SPO0109.t01
product: hypothetical protein
protein_id: REF_tigr:SPO0109
  YP_165383.1
transl_table: 11
translation: MWQWLTNVFRLGLKELNSLRADPVLILLIVYVFSFAVYSVATGAKLEVSNASVAYVDQDR SALTGRILGAILPPEFNPPQEISAGEIESVMNSGKFVFVLSFPPSFEADVLSGHKPQIQL NVDATAMAQAGNGSVFLQQIILAEVAKFVSGDDITTTRLIDLVVRTKFNPNLNSIWFSSV MQIINNITILSVLLTGAALIREREHGTIEHLLVMPVTPSEIMVAKIWANGLVIVVAAILS LWIVVQTVLAVPIAGSIPLFVCGAVLYLASVTGLGILLATFTTSMPQFGLLSLPVLVIMN LLSGSTTPMESMPVWLQNVMQLSPSTHFVSFSQAILYRDAGLDIVWPDMVVMVALSAVFF FIALKRFRVTMATVR
Type: exon
Description:
Source: GenBank
Position: DSS3:113139..114266 (- strand)
Length: 1128
parent_id: SPO0109.t01
> class=Sequence position=DSS3:113139..114266 (- strand)
ATGTGGCAAT GGCTTACCAA TGTCTTCCGG CTTGGCCTCA AGGAACTCAA CAGCCTGCGT GCCGATCCCG TGCTTATTCT
GCTGATCGTC TATGTGTTCA GCTTCGCCGT CTATTCGGTT GCGACCGGTG CCAAGCTTGA GGTCTCGAAC GCCTCTGTCG
CCTATGTGGA CCAGGACCGT TCGGCACTGA CGGGGCGCAT TTTGGGCGCG ATCCTTCCAC CCGAATTCAA TCCGCCACAG
GAAATCTCGG CCGGTGAGAT TGAAAGCGTG ATGAACAGCG GCAAGTTCGT GTTTGTCCTG TCATTTCCAC CCAGTTTCGA
GGCGGATGTG CTGAGCGGCC ACAAACCTCA GATACAGCTC AACGTGGATG CCACCGCAAT GGCACAGGCC GGTAACGGTT
CGGTGTTCCT TCAGCAGATC ATCCTCGCTG AAGTCGCCAA GTTCGTTTCC GGCGACGACA TCACAACCAC TCGGCTGATC
GACCTGGTCG TCAGGACAAA GTTCAATCCG AACCTGAATT CCATCTGGTT TTCATCCGTG ATGCAGATCA TCAACAACAT
CACCATCCTG TCTGTACTTT TGACCGGCGC CGCGCTGATC CGCGAGCGCG AACATGGCAC GATCGAACAT TTGCTGGTGA
TGCCGGTCAC CCCGTCCGAG ATCATGGTTG CCAAGATATG GGCCAACGGC CTTGTGATCG TTGTCGCCGC CATCCTGTCG
CTCTGGATCG TCGTGCAGAC CGTGTTGGCG GTTCCGATCG CGGGTTCGAT CCCGCTCTTC GTATGCGGGG CGGTGCTTTA
CCTTGCCTCG GTCACGGGGC TCGGTATCCT GCTGGCCACC TTCACCACGT CGATGCCGCA ATTCGGTCTG TTGTCGCTCC
CGGTTCTCGT GATCATGAAT TTGCTGTCCG GCAGTACGAC GCCGATGGAA AGCATGCCGG TCTGGCTTCA GAACGTCATG
CAGTTGTCAC CGTCGACACA TTTCGTGTCG TTTTCTCAAG CCATTCTCTA TCGCGATGCC GGACTGGATA TCGTCTGGCC
CGACATGGTG GTCATGGTCG CGCTCAGCGC GGTCTTTTTC TTCATCGCGC TCAAGCGATT CAGGGTGACC ATGGCCACAG
TTCGCTAA
>SPO0109 class=Sequence position=DSS3:113139..114266 (- strand)
ATGTGGCAAT GGCTTACCAA TGTCTTCCGG CTTGGCCTCA AGGAACTCAA CAGCCTGCGT GCCGATCCCG TGCTTATTCT
GCTGATCGTC TATGTGTTCA GCTTCGCCGT CTATTCGGTT GCGACCGGTG CCAAGCTTGA GGTCTCGAAC GCCTCTGTCG
CCTATGTGGA CCAGGACCGT TCGGCACTGA CGGGGCGCAT TTTGGGCGCG ATCCTTCCAC CCGAATTCAA TCCGCCACAG
GAAATCTCGG CCGGTGAGAT TGAAAGCGTG ATGAACAGCG GCAAGTTCGT GTTTGTCCTG TCATTTCCAC CCAGTTTCGA
GGCGGATGTG CTGAGCGGCC ACAAACCTCA GATACAGCTC AACGTGGATG CCACCGCAAT GGCACAGGCC GGTAACGGTT
CGGTGTTCCT TCAGCAGATC ATCCTCGCTG AAGTCGCCAA GTTCGTTTCC GGCGACGACA TCACAACCAC TCGGCTGATC
GACCTGGTCG TCAGGACAAA GTTCAATCCG AACCTGAATT CCATCTGGTT TTCATCCGTG ATGCAGATCA TCAACAACAT
CACCATCCTG TCTGTACTTT TGACCGGCGC CGCGCTGATC CGCGAGCGCG AACATGGCAC GATCGAACAT TTGCTGGTGA
TGCCGGTCAC CCCGTCCGAG ATCATGGTTG CCAAGATATG GGCCAACGGC CTTGTGATCG TTGTCGCCGC CATCCTGTCG
CTCTGGATCG TCGTGCAGAC CGTGTTGGCG GTTCCGATCG CGGGTTCGAT CCCGCTCTTC GTATGCGGGG CGGTGCTTTA
CCTTGCCTCG GTCACGGGGC TCGGTATCCT GCTGGCCACC TTCACCACGT CGATGCCGCA ATTCGGTCTG TTGTCGCTCC
CGGTTCTCGT GATCATGAAT TTGCTGTCCG GCAGTACGAC GCCGATGGAA AGCATGCCGG TCTGGCTTCA GAACGTCATG
CAGTTGTCAC CGTCGACACA TTTCGTGTCG TTTTCTCAAG CCATTCTCTA TCGCGATGCC GGACTGGATA TCGTCTGGCC
CGACATGGTG GTCATGGTCG CGCTCAGCGC GGTCTTTTTC TTCATCGCGC TCAAGCGATT CAGGGTGACC ATGGCCACAG
TTCGCTAA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7