Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0110
Type: CDS
Description: identified by match to protein family HMM PF00005; match to protein family HMM PF01061
Source: Genbank
Position: CP000031.2:114268..116994 (- strand)
Length: 2727
"ID: cds-AAV93440.1
Dbxref: NCBI_GP:AAV93440.1
IMG: SPO0110: ABC transporter
  ATP binding/permease protein
Note: identified by match to protein family HMM PF00005; match to protein family HMM PF01061
RefSeq: SPO_RS00550: ribosome-associated ATPase/putative transporter RbbA"
gbkey: CDS
gene: SPO0110
locus_tag: SPO0110
parent_id: gene-SPO0110
product: ABC transporter
  ATP binding/permease protein
protein_id: AAV93440.1
transl_table: 11
translation: MTPAPVASLSAVTHRYGSTLALSDVTLDIPAGCMAGLIGPDGVGKSTLLALIAGVRKLQA GGAIVLGGDITDRHHLRACNHRIAYMPQGLGRNLYPTLSVYENLDFFGRLFGQSEAERRA RINNLLTATGLDPFPDRPAGKLSGGMKQKLSLCSALIHDPDLVILDEPTTGVDPLSRQQF WDLIDHIREERPAMSVIVATAYMEEAERFDWLAAMNAGQVISTGSPIEIRNAAGQPTLEK AFIAMLPEADRQGHRIDEVPPRRPVIGPPAIEAKGLTCRFGDFIAVDHVEFQIEPGEIFG FLGSNGCGKTTTMKMLTGLQKASEGKALLFGEALNPDDMATRRQVGYMSQSFSLYGELTV RQNLELHARLYQLPIETRAERVAQMLHDFDLAEEADKRPDGLPLGIRQRLQLAVAVIHSP EVLILDEPTSGVDPVARDGFWRHLIKLSRDDGVTIFVSTHFMNEAARCDRISLMHAGKVL AVGTPEDLARSKDTDDLEEAFVGYLREAAGNTDGRASETPAAKLPDRLEKPDRLFDLARL WAFARRESIEILRDPMRLAFAFLGPVILMLTFGYGISFDVQELPYAVLDRDKSAESRNLM QSFSGSRYFVERPAAGSVTELDIRMRSSELVIAVEVPPGFGKSLLRGDQPEVRVAVDGAM PFRAETTRGYLQGLAASYMSDQTERLYGHAFDPSAASVETRFRYNQAFKSVFALIPSVIM LMLVLIPAMMAAMGVVREKETGSIANFRSTPVTRTEFILGKQLPYVAIAMLSFASLIIVS YGVFGVLIKGSVLALLVGTLLYVLATTGFGVLVSTFTRTQVAATFAAAVISIIPAVNFSG LLVPVSSLSGGGRLIGLSFPSSWYQQISMGTFTKGLGFPELWLNHVALAGFAALFIAVSV LALNKQET
>SPO0110 class=Sequence position=CP000031.2:114268..116994 (- strand)
ATGACGCCCG CACCTGTCGC CAGCCTGTCT GCGGTTACCC ACCGCTATGG CTCCACGTTG GCCCTGTCCG ACGTCACGCT
GGATATCCCG GCGGGCTGCA TGGCAGGGCT GATCGGCCCA GACGGGGTCG GGAAATCCAC CTTGCTGGCG TTGATCGCCG
GCGTGCGCAA ACTGCAAGCC GGCGGCGCGA TCGTGCTGGG CGGCGATATC ACCGACCGCC ACCACCTCAG GGCGTGCAAC
CATCGCATCG CCTACATGCC GCAGGGTCTT GGCCGGAACC TTTACCCGAC GCTCTCGGTC TATGAAAACC TGGACTTTTT
CGGCAGACTC TTTGGCCAGT CGGAAGCCGA ACGCCGCGCC CGCATCAACA ATCTTCTGAC CGCCACCGGG CTTGATCCGT
TCCCGGACCG GCCCGCAGGC AAGCTGTCCG GCGGGATGAA GCAGAAACTC TCGCTCTGCT CGGCACTGAT CCACGATCCA
GACCTGGTGA TCCTTGACGA ACCGACCACT GGGGTCGATC CGCTGTCACG CCAGCAGTTC TGGGATCTGA TCGACCATAT
CCGCGAAGAA CGCCCGGCGA TGAGCGTAAT CGTGGCCACC GCATACATGG AAGAGGCGGA GCGCTTTGAC TGGCTTGCCG
CGATGAATGC GGGACAGGTG ATCTCGACGG GATCGCCGAT CGAGATCCGG AACGCTGCCG GGCAACCGAC ACTGGAAAAG
GCCTTCATTG CCATGCTGCC CGAGGCGGAC CGGCAAGGCC ACCGCATAGA CGAAGTACCA CCGCGCAGAC CTGTCATCGG
CCCACCTGCC ATCGAGGCGA AAGGCCTGAC CTGCCGTTTC GGCGATTTCA TCGCGGTCGA TCATGTCGAA TTCCAGATCG
AGCCGGGCGA GATCTTCGGA TTCCTCGGCT CGAACGGCTG CGGCAAGACC ACCACCATGA AGATGCTGAC CGGGCTACAG
AAGGCCAGCG AAGGCAAGGC GCTTCTGTTC GGAGAGGCGC TGAATCCGGA CGACATGGCG ACCCGACGGC AGGTCGGCTA
CATGTCGCAG TCCTTTTCCC TCTATGGTGA ATTGACCGTC CGCCAGAACC TTGAGCTTCA TGCGCGGCTC TACCAGTTGC
CGATCGAGAC CCGCGCAGAG CGGGTCGCAC AGATGCTGCA TGATTTCGAT CTGGCCGAGG AGGCGGACAA ACGGCCGGAC
GGCCTGCCGC TGGGCATCCG TCAACGTCTG CAACTTGCCG TCGCGGTGAT CCACTCCCCG GAGGTTCTGA TCCTGGACGA
GCCGACCTCG GGCGTCGATC CAGTCGCACG GGACGGGTTC TGGCGACACC TGATCAAGCT GTCGCGCGAC GACGGCGTGA
CGATCTTCGT CTCGACCCAT TTCATGAACG AAGCGGCGCG ATGCGACCGC ATCTCATTGA TGCACGCGGG AAAGGTTTTG
GCGGTGGGAA CGCCCGAAGA CCTGGCGCGA AGCAAAGATA CGGATGACCT CGAAGAAGCA TTTGTCGGAT ATCTGCGCGA
GGCGGCAGGC AATACCGATG GCAGGGCGTC CGAGACACCT GCGGCAAAAT TGCCGGACAG GCTGGAAAAA CCTGATCGCC
TCTTCGATTT GGCCCGGCTT TGGGCCTTTG CGCGCCGCGA GTCGATCGAG ATATTGCGGG ACCCGATGCG CCTTGCCTTT
GCGTTTCTGG GTCCGGTCAT CTTGATGCTC ACTTTCGGTT ATGGAATTTC ATTCGATGTG CAGGAACTGC CCTATGCGGT
TCTCGATCGT GACAAGAGCG CAGAAAGCCG GAACCTCATG CAGAGCTTCT CCGGCTCGCG CTACTTCGTT GAAAGGCCGG
CTGCGGGCAG TGTGACCGAG CTTGATATTC GCATGAGAAG CTCCGAACTT GTCATCGCTG TCGAGGTGCC GCCGGGGTTT
GGAAAATCCC TGCTGCGCGG TGATCAACCA GAAGTCCGCG TTGCCGTTGA CGGAGCTATG CCATTCCGGG CGGAAACGAC
ACGCGGCTAT CTGCAGGGGC TCGCGGCATC CTACATGTCC GATCAGACTG AACGGCTTTA TGGCCATGCC TTCGACCCGT
CGGCAGCCTC GGTTGAAACC CGGTTTCGCT ACAATCAGGC GTTCAAGAGC GTCTTTGCGC TGATCCCTTC GGTTATCATG
CTGATGCTGG TTCTGATCCC CGCAATGATG GCGGCGATGG GGGTCGTGCG GGAAAAGGAA ACCGGTTCGA TCGCCAATTT
CCGCTCGACG CCGGTGACGC GAACCGAGTT CATTCTGGGC AAGCAGCTGC CGTATGTCGC GATTGCCATG CTCAGCTTTG
CCTCGCTGAT CATCGTTTCC TATGGCGTCT TCGGTGTATT GATCAAAGGC TCTGTCCTAG CGCTCCTTGT CGGCACATTG
CTTTACGTGC TGGCGACAAC GGGCTTTGGT GTGTTGGTCT CGACATTTAC CCGCACGCAG GTTGCGGCAA CCTTTGCCGC
CGCGGTAATT TCGATCATTC CGGCTGTCAA CTTCTCGGGC CTTCTGGTGC CGGTGTCCTC GCTTTCGGGT GGCGGCCGTC
TGATCGGTCT GTCCTTCCCA TCGTCCTGGT ATCAGCAGAT CAGTATGGGC ACCTTCACCA AAGGCCTCGG ATTCCCCGAA
CTCTGGCTCA ACCACGTCGC TCTGGCGGGC TTTGCGGCCT TGTTCATTGC GGTGTCGGTC CTTGCCTTGA ACAAGCAGGA
GACATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7