Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0111
Type: CDS
Description: identified by similarity to PIR:H82993
Source: Genbank
Position: CP000031.2:116991..118055 (- strand)
Length: 1065
Dbxref: NCBI_GP:AAV93441.1
IMG: SPO0111: HlyD family secretion protein
Note: identified by similarity to PIR:H82993
RefSeq: SPO_RS00555: HlyD family efflux transporter periplasmic adaptor subunit
gbkey: CDS
gene: SPO0111
load_id: cds-AAV93441.1
locus_tag: SPO0111
parent_id: gene-SPO0111
product: hypothetical protein
protein_id: AAV93441.1
transl_table: 11
translation: MCLRGTAAKLSSGSLGDLAGTEMRRRPMQWKRYGTVAVILSVLLGGAYVFWLDSQTAELP AGIVRSNGRIEAERIDVATKLPGRIAEVRVSEGQWVEAGSLVAHMDTAEIDAQLRQAKAA VAQAEQQKLQTEALLNQRLSEQEFAQAEFARAEQLAARGHAPQELVDQRKSALTTADAGV AAARAGIDLATATIASADATVERLQSIRADADLVAPHDGRVQYILAKAGEVVGAGGRVVT LTDLTDIYMTIFLPARDAGLLAIGSEARIVLDPIPEYVIPATVTFVASTAQFTPKSVETA DERDQLMFRVKLTIPEDLLKAYQEQAKAGVAGVGYVRTDDTAPWPDVLSVKLPQ
>SPO0111 class=Sequence position=CP000031.2:116991..118055 (- strand)
ATGTGTTTAC GCGGCACTGC AGCGAAACTA AGTTCAGGAA GCCTTGGTGA TTTAGCGGGC ACCGAGATGA GGAGAAGACC
AATGCAATGG AAACGCTATG GCACAGTTGC TGTCATCCTC AGCGTGCTTT TGGGCGGCGC ATACGTATTC TGGTTGGACA
GCCAAACCGC AGAGCTCCCG GCTGGCATCG TCAGGTCGAA CGGGCGGATC GAGGCAGAGC GTATCGATGT GGCGACTAAG
CTTCCGGGGC GTATCGCCGA GGTGCGCGTT TCCGAGGGCC AGTGGGTCGA GGCAGGAAGC CTGGTGGCGC ATATGGATAC
TGCCGAGATC GACGCCCAGT TGCGCCAAGC CAAGGCCGCC GTCGCCCAGG CAGAGCAGCA GAAACTGCAA ACCGAGGCCC
TGCTGAACCA ACGCCTGTCC GAACAGGAAT TCGCGCAGGC GGAATTTGCC CGCGCCGAGC AACTTGCCGC AAGGGGGCAC
GCGCCACAGG AACTGGTCGA TCAAAGAAAA TCCGCCCTGA CAACCGCAGA TGCCGGAGTG GCCGCCGCCC GAGCAGGCAT
CGATCTTGCA ACTGCTACGA TCGCCTCGGC AGACGCAACA GTTGAACGAC TGCAAAGCAT CCGGGCCGAT GCAGATCTGG
TGGCTCCGCA CGATGGGCGA GTTCAATACA TCCTCGCCAA GGCAGGAGAA GTTGTCGGCG CCGGTGGCAG GGTCGTGACG
CTGACCGATC TGACCGACAT CTACATGACG ATCTTTCTTC CCGCGCGCGA CGCCGGTCTG CTGGCCATCG GTTCCGAGGC
GCGGATTGTC CTGGATCCGA TCCCAGAATA CGTGATCCCG GCAACCGTCA CGTTTGTCGC CAGCACAGCC CAATTCACCC
CGAAATCGGT CGAGACGGCG GATGAGCGCG ATCAGTTGAT GTTTCGCGTC AAGCTGACAA TCCCCGAGGA CCTGCTGAAG
GCATATCAGG AACAGGCCAA AGCGGGTGTT GCCGGAGTGG GCTATGTCCG CACCGACGAC ACTGCCCCCT GGCCCGACGT
GCTGTCGGTG AAGCTGCCGC AATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7