Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0114
Type: CDS
Description: identified by Glimmer2; putative
Source: Genbank
Position: CP000031.2:120897..121097 (+ strand)
Length: 201
Dbxref: NCBI_GP:AAV93444.1
IMG:
Note: identified by Glimmer2; putative
RefSeq: SPO_RS00570: hypothetical protein
gbkey: CDS
gene: SPO0114
load_id: cds-AAV93444.1
locus_tag: SPO0114
parent_id: gene-SPO0114
product: hypothetical protein
protein_id: AAV93444.1
transl_table: 11
translation: MIKMSFNCTPDATFPTGKGATEQRFTATVGGDELEIDTHPWGEADLKINDKLVAHVDGDR SGVSSG
>SPO0114 class=Sequence position=CP000031.2:120897..121097 (+ strand)
ATGATCAAGA TGTCTTTCAA CTGTACGCCG GACGCCACCT TTCCGACCGG CAAAGGCGCC ACCGAACAAC GTTTTACCGC
GACTGTAGGT GGCGATGAGT TGGAAATCGA CACGCATCCC TGGGGTGAAG CCGACCTGAA GATCAACGAC AAGCTTGTTG
CCCATGTCGA CGGCGACCGG TCCGGCGTGA GTTCGGGATA G

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7