Roseobase: Ruegeria pomeroyi DSS-3

Name: SPO0115
Type: CDS
Description: identified by match to protein family HMM PF01515; match to protein family HMM PF01575; NCBI:bifunctional enoyl-CoA hydratase /phosphate acetyltransferase; IMG:phosphate acetyltransferase
Source: GenBank
Position: DSS3:121130..122524 (+ strand)
Length: 1395
Dbxref: GI:56695042
  GeneID:3194439
Note: identified by match to protein family HMM PF01515; match to protein family HMM PF01575
  NCBI:bifunctional enoyl-CoA hydratase /phosphate acetyltransferase
  IMG:phosphate acetyltransferase
codon_start: 1
load_id: SPO0115.p01
parent_id: SPO0115.t01
product: maoC family protein/phosphate acetyl/butaryl transferase
protein_id: REF_tigr:SPO0115
  YP_165389.1
transl_table: 11
translation: MQYIENKTFDEIRIGDSAELTRKLKADDIELFAVMSGDVNPAHVDEEYARSDMFHEVVAH GMWGGALISAVLGTELPGPGTIYLNQNLSFRRPVGLGDTVTVRVTVASKDAGTKRLKLDC LCVNQDGETVIKGQAEVIAPSEKVRRPRVVLPDVHLHERGARYRDLIAATHAMAPVRTAI VHPCDALSLTGALEAASQGLIVPILVAPRVKLEAVAEEAGLVLDGVEIVDVPHSHAAAER AVALVRCGKAEALMKGKLHTDELMDPVVDRDTGLRSERRMSHIFALDVPHYPKPLFVTDA AINIFPDLDTKRDIVQNAIDLAQALGIDRPKVAILSAVETVYPKIPSTIEAAALCKMWDR GQITGGVLDGPLAFDNAVSKSAAKAKGIVSEVAGDADILVVPDLEAGNMIAKQLIHLAGA EAAGIVLGARVPIILTSRADGVMSRLASSAMAQLYIHHAKKVVS
>SPO0115 class=Sequence position=DSS3:121130..122524 (+ strand)
ATGCAGTACA TCGAAAACAA GACGTTCGAC GAAATCAGGA TTGGCGACAG TGCCGAACTG ACCCGCAAGC TAAAGGCCGA
TGACATCGAG CTTTTCGCGG TGATGTCGGG CGATGTGAAC CCGGCCCATG TCGATGAGGA ATACGCCAGG TCGGACATGT
TTCACGAAGT CGTCGCACAC GGCATGTGGG GCGGCGCGCT GATTTCGGCG GTTCTGGGCA CCGAACTTCC CGGCCCCGGC
ACGATCTACC TCAACCAGAA CCTCAGCTTT CGCCGCCCCG TGGGGTTGGG CGATACCGTG ACGGTTCGCG TGACCGTGGC
CTCGAAGGAT GCCGGGACCA AGCGGCTGAA GCTTGACTGC CTTTGCGTCA ATCAGGACGG AGAGACCGTT ATCAAAGGGC
AGGCCGAGGT CATCGCGCCG TCCGAGAAGG TCCGTCGCCC CCGCGTGGTC CTGCCCGACG TGCATCTGCA CGAACGGGGC
GCGCGCTATC GCGACCTGAT CGCGGCGACA CATGCGATGG CGCCGGTGCG CACCGCCATT GTCCATCCCT GCGACGCTCT
GTCACTGACC GGCGCGCTGG AGGCGGCAAG CCAGGGGCTG ATCGTCCCGA TCCTCGTCGC ACCCAGGGTG AAACTCGAAG
CCGTGGCCGA AGAGGCCGGC CTTGTCCTTG ACGGTGTCGA GATCGTGGAT GTCCCGCACA GCCACGCGGC CGCCGAACGG
GCTGTCGCGC TGGTCCGCTG CGGCAAGGCC GAAGCGTTGA TGAAAGGCAA GTTGCACACC GACGAATTGA TGGATCCGGT
GGTTGACCGC GACACGGGCC TGCGCAGCGA ACGCCGGATG AGTCATATTT TCGCTCTCGA CGTGCCGCAC TATCCCAAGC
CTCTTTTCGT GACCGACGCG GCGATCAACA TCTTTCCCGA CCTCGATACC AAGCGAGACA TCGTGCAAAA CGCCATCGAT
CTGGCGCAGG CGCTGGGGAT CGACCGGCCA AAGGTCGCGA TCCTTTCTGC GGTGGAAACG GTCTATCCCA AGATCCCGTC
CACTATCGAG GCCGCTGCAC TGTGCAAGAT GTGGGACCGT GGCCAGATCA CCGGCGGCGT GCTCGACGGC CCCTTGGCCT
TCGACAACGC CGTGTCGAAG TCAGCGGCAA AGGCCAAGGG CATCGTCTCG GAAGTGGCGG GCGATGCCGA TATCCTCGTC
GTGCCTGATC TCGAGGCGGG CAACATGATC GCCAAGCAAC TGATCCATCT TGCGGGTGCC GAGGCTGCAG GGATTGTCCT
CGGCGCTCGC GTACCGATCA TTCTGACCAG CCGGGCGGAT GGCGTGATGT CGCGGCTCGC ATCATCGGCA ATGGCACAGC
TTTACATCCA CCACGCGAAA AAGGTCGTGT CATGA

Please select the sequence type:


For the source code for this browser, see the Generic Model Organism Database Project.

Note: This page uses cookies to save and restore preference information. No information is shared.
Generic genome browser version 1.7